The AMI (ATLAS Metadata Interface) 2.0 metadata ecosystem: new design principles and features.

AMI (ATLAS Metadata Interface) is a generic ecosystem for metadata aggregation, transformation and cataloguing. Benefitting from more than 15 years of feedback in the LHC context, the second major version was recently released. We describe the design choices and their benefits for providing high-lev...

Descripción completa

Detalles Bibliográficos
Autores principales: Odier, Jerome, Lambert, Fabian, Fulachier, Jerome, Delsart, Pierre-Antoine
Lenguaje:eng
Publicado: 2018
Materias:
Particle Physics - Experiment
Acceso en línea:http://cds.cern.ch/record/2628488
_version_ 1780959171199369216
author Odier, Jerome
Lambert, Fabian
Fulachier, Jerome
Delsart, Pierre-Antoine
author_facet Odier, Jerome
Lambert, Fabian
Fulachier, Jerome
Delsart, Pierre-Antoine
author_sort Odier, Jerome
collection CERN
description AMI (ATLAS Metadata Interface) is a generic ecosystem for metadata aggregation, transformation and cataloguing. Benefitting from more than 15 years of feedback in the LHC context, the second major version was recently released. We describe the design choices and their benefits for providing high-level metadata-dedicated features. In particular, we focus on the implementation of the Metadata Querying Language (MQL), a domain-specific language allowing to query databases without knowing the relation between entities. Finally, we emphasise the assets of the ecosystem for deploying an AMI service and extending its functionalities.
id cern-2628488
institution Organización Europea para la Investigación Nuclear
language eng
publishDate 2018
record_format invenio
spelling cern-26284882019-11-08T10:49:22Zhttp://cds.cern.ch/record/2628488engOdier, JeromeLambert, FabianFulachier, JeromeDelsart, Pierre-AntoineThe AMI (ATLAS Metadata Interface) 2.0 metadata ecosystem: new design principles and features.Particle Physics - ExperimentAMI (ATLAS Metadata Interface) is a generic ecosystem for metadata aggregation, transformation and cataloguing. Benefitting from more than 15 years of feedback in the LHC context, the second major version was recently released. We describe the design choices and their benefits for providing high-level metadata-dedicated features. In particular, we focus on the implementation of the Metadata Querying Language (MQL), a domain-specific language allowing to query databases without knowing the relation between entities. Finally, we emphasise the assets of the ecosystem for deploying an AMI service and extending its functionalities.ATL-SOFT-SLIDE-2018-458oai:cds.cern.ch:26284882018-07-04
spellingShingle Particle Physics - Experiment
Odier, Jerome
Lambert, Fabian
Fulachier, Jerome
Delsart, Pierre-Antoine
The AMI (ATLAS Metadata Interface) 2.0 metadata ecosystem: new design principles and features.
title The AMI (ATLAS Metadata Interface) 2.0 metadata ecosystem: new design principles and features.
title_full The AMI (ATLAS Metadata Interface) 2.0 metadata ecosystem: new design principles and features.
title_fullStr The AMI (ATLAS Metadata Interface) 2.0 metadata ecosystem: new design principles and features.
title_full_unstemmed The AMI (ATLAS Metadata Interface) 2.0 metadata ecosystem: new design principles and features.
title_short The AMI (ATLAS Metadata Interface) 2.0 metadata ecosystem: new design principles and features.
title_sort ami (atlas metadata interface) 2.0 metadata ecosystem: new design principles and features.
topic Particle Physics - Experiment
url http://cds.cern.ch/record/2628488
work_keys_str_mv AT odierjerome theamiatlasmetadatainterface20metadataecosystemnewdesignprinciplesandfeatures
AT lambertfabian theamiatlasmetadatainterface20metadataecosystemnewdesignprinciplesandfeatures
AT fulachierjerome theamiatlasmetadatainterface20metadataecosystemnewdesignprinciplesandfeatures
AT delsartpierreantoine theamiatlasmetadatainterface20metadataecosystemnewdesignprinciplesandfeatures
AT odierjerome amiatlasmetadatainterface20metadataecosystemnewdesignprinciplesandfeatures
AT lambertfabian amiatlasmetadatainterface20metadataecosystemnewdesignprinciplesandfeatures
AT fulachierjerome amiatlasmetadatainterface20metadataecosystemnewdesignprinciplesandfeatures
AT delsartpierreantoine amiatlasmetadatainterface20metadataecosystemnewdesignprinciplesandfeatures

Ejemplares similares