The ATLAS Metadata Interface (AMI) 2.0 metadata ecosystem: new design principles and features

ATLAS Metadata Interface (AMI) is a generic ecosystem for metadata aggregation, transformation and cataloging. Benefiting from 18 years of feedback in the LHC context, the second major version was recently released. This paper describes the design choices and their benefits for providing high-level...

Descripción completa

Detalles Bibliográficos
Autores principales: Odier, Jerome, Lambert, Fabian, Fulachier, Jerome
Lenguaje:eng
Publicado: 2018
Materias:
Particle Physics - Experiment
Acceso en línea:https://dx.doi.org/10.1051/epjconf/201921405046
http://cds.cern.ch/record/2649430
_version_ 1780960735546834944
author Odier, Jerome
Lambert, Fabian
Fulachier, Jerome
author_facet Odier, Jerome
Lambert, Fabian
Fulachier, Jerome
author_sort Odier, Jerome
collection CERN
description ATLAS Metadata Interface (AMI) is a generic ecosystem for metadata aggregation, transformation and cataloging. Benefiting from 18 years of feedback in the LHC context, the second major version was recently released. This paper describes the design choices and their benefits for providing high-level metadata-dedicated features. In particular, the Metadata Querying Language (MQL) - a domain-specific language allowing to query databases without knowing the relation between entities - and on the AMI Web framework are described.
id cern-2649430
institution Organización Europea para la Investigación Nuclear
language eng
publishDate 2018
record_format invenio
spelling cern-26494302022-08-10T12:23:12Zdoi:10.1051/epjconf/201921405046http://cds.cern.ch/record/2649430engOdier, JeromeLambert, FabianFulachier, JeromeThe ATLAS Metadata Interface (AMI) 2.0 metadata ecosystem: new design principles and featuresParticle Physics - ExperimentATLAS Metadata Interface (AMI) is a generic ecosystem for metadata aggregation, transformation and cataloging. Benefiting from 18 years of feedback in the LHC context, the second major version was recently released. This paper describes the design choices and their benefits for providing high-level metadata-dedicated features. In particular, the Metadata Querying Language (MQL) - a domain-specific language allowing to query databases without knowing the relation between entities - and on the AMI Web framework are described.ATL-SOFT-PROC-2018-045oai:cds.cern.ch:26494302018-11-30
spellingShingle Particle Physics - Experiment
Odier, Jerome
Lambert, Fabian
Fulachier, Jerome
The ATLAS Metadata Interface (AMI) 2.0 metadata ecosystem: new design principles and features
title The ATLAS Metadata Interface (AMI) 2.0 metadata ecosystem: new design principles and features
title_full The ATLAS Metadata Interface (AMI) 2.0 metadata ecosystem: new design principles and features
title_fullStr The ATLAS Metadata Interface (AMI) 2.0 metadata ecosystem: new design principles and features
title_full_unstemmed The ATLAS Metadata Interface (AMI) 2.0 metadata ecosystem: new design principles and features
title_short The ATLAS Metadata Interface (AMI) 2.0 metadata ecosystem: new design principles and features
title_sort atlas metadata interface (ami) 2.0 metadata ecosystem: new design principles and features
topic Particle Physics - Experiment
url https://dx.doi.org/10.1051/epjconf/201921405046
http://cds.cern.ch/record/2649430
work_keys_str_mv AT odierjerome theatlasmetadatainterfaceami20metadataecosystemnewdesignprinciplesandfeatures
AT lambertfabian theatlasmetadatainterfaceami20metadataecosystemnewdesignprinciplesandfeatures
AT fulachierjerome theatlasmetadatainterfaceami20metadataecosystemnewdesignprinciplesandfeatures
AT odierjerome atlasmetadatainterfaceami20metadataecosystemnewdesignprinciplesandfeatures
AT lambertfabian atlasmetadatainterfaceami20metadataecosystemnewdesignprinciplesandfeatures
AT fulachierjerome atlasmetadatainterfaceami20metadataecosystemnewdesignprinciplesandfeatures

Ejemplares similares