Cargando…

Barriers and facilitators of integration of pharmacists in the provision of clinical pharmacy services in Tanzania

BACKGROUND: Collaboration between medical doctors and nurses in the provision of healthcare services has been there for decades. The concept of clinical pharmacy services as a main goal for pharmacy practice is relatively new and is yielding more positive results for healthcare providers (HCPs), pat...

Descripción completa

Detalles Bibliográficos
Autores principales: Kilonzi, Manase, Mutagonda, Ritah F., Mlyuka, Hamu J., Mwakawanga, Dorkasi L., Mikomangwa, Wigilya P., Kibanga, Wema A., Marealle, Alphonce Ignace, Mallya, Bertha, Katabalo, Deogratias, Sanga, Sofia, Kalokola, Fredrick, Rwegasha, John, Magambo, Rose, Mmassy, John, Kabissi, Sungwa, Balati, Josephine A., Maduki, Peter, OmaryMashikuMinzi, Kamuhabwa, Appolinary A. R.
Formato: Online Artículo Texto
Lenguaje:English
Publicado: BioMed Central 2023
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10021921/
https://www.ncbi.nlm.nih.gov/pubmed/36932338
http://dx.doi.org/10.1186/s12875-023-02026-4
_version_ 1784908612683956224
author Kilonzi, Manase
Mutagonda, Ritah F.
Mlyuka, Hamu J.
Mwakawanga, Dorkasi L.
Mikomangwa, Wigilya P.
Kibanga, Wema A.
Marealle, Alphonce Ignace
Mallya, Bertha
Katabalo, Deogratias
Sanga, Sofia
Kalokola, Fredrick
Rwegasha, John
Magambo, Rose
Mmassy, John
Kabissi, Sungwa
Balati, Josephine A.
Maduki, Peter
OmaryMashikuMinzi
Kamuhabwa, Appolinary A. R.
author_facet Kilonzi, Manase
Mutagonda, Ritah F.
Mlyuka, Hamu J.
Mwakawanga, Dorkasi L.
Mikomangwa, Wigilya P.
Kibanga, Wema A.
Marealle, Alphonce Ignace
Mallya, Bertha
Katabalo, Deogratias
Sanga, Sofia
Kalokola, Fredrick
Rwegasha, John
Magambo, Rose
Mmassy, John
Kabissi, Sungwa
Balati, Josephine A.
Maduki, Peter
OmaryMashikuMinzi
Kamuhabwa, Appolinary A. R.
author_sort Kilonzi, Manase
collection PubMed
description BACKGROUND: Collaboration between medical doctors and nurses in the provision of healthcare services has been there for decades. The concept of clinical pharmacy services as a main goal for pharmacy practice is relatively new and is yielding more positive results for healthcare providers (HCPs), patients, and the health system. This study assessed barriers and facilitators toward the integration of pharmacists in the provision of CPS in Tanzania. METHODS: A qualitative study was conducted in five tertiary hospitals representing Tanzania mainland. Ten (10) focus group discussions (FGDs) with 83 HCPs and 14 in-depth interviews (IDIs) with hospital administrators in referral hospitals were conducted between August and September 2021. The experienced qualitative researchers moderated the IDIs and FGDs, and all discussions were audio-recorded. Finally, the audios were transcribed verbatim, and analysis was done using a thematic approach. RESULTS: Limited skills, lack of confidence, poor communication, inferiority, and superiority behaviors among HCPs were among the mentioned barriers. Shortage of pharmacists, lack of in-job training, standard operating procedures (SOPs), and guidelines were also mentioned. The study noted the high acceptability of CPS by other HCPs, the positive perception of pharmacists, and the recognition of CPS by the Tanzania Pharmacy Act and regulation. CONCLUSION: The facilitators and barriers to the integration of pharmacists in the provision of CPS lie at the individual, health facility, and health system levels. Therefore, the study recommends in-job pharmacists training, fostering teamwork among HCPs, and development of CPS SoPs, and guidelines.
format Online
Article
Text
id pubmed-10021921
institution National Center for Biotechnology Information
language English
publishDate 2023
publisher BioMed Central
record_format MEDLINE/PubMed
spelling pubmed-100219212023-03-18 Barriers and facilitators of integration of pharmacists in the provision of clinical pharmacy services in Tanzania Kilonzi, Manase Mutagonda, Ritah F. Mlyuka, Hamu J. Mwakawanga, Dorkasi L. Mikomangwa, Wigilya P. Kibanga, Wema A. Marealle, Alphonce Ignace Mallya, Bertha Katabalo, Deogratias Sanga, Sofia Kalokola, Fredrick Rwegasha, John Magambo, Rose Mmassy, John Kabissi, Sungwa Balati, Josephine A. Maduki, Peter OmaryMashikuMinzi Kamuhabwa, Appolinary A. R. BMC Prim Care Research BACKGROUND: Collaboration between medical doctors and nurses in the provision of healthcare services has been there for decades. The concept of clinical pharmacy services as a main goal for pharmacy practice is relatively new and is yielding more positive results for healthcare providers (HCPs), patients, and the health system. This study assessed barriers and facilitators toward the integration of pharmacists in the provision of CPS in Tanzania. METHODS: A qualitative study was conducted in five tertiary hospitals representing Tanzania mainland. Ten (10) focus group discussions (FGDs) with 83 HCPs and 14 in-depth interviews (IDIs) with hospital administrators in referral hospitals were conducted between August and September 2021. The experienced qualitative researchers moderated the IDIs and FGDs, and all discussions were audio-recorded. Finally, the audios were transcribed verbatim, and analysis was done using a thematic approach. RESULTS: Limited skills, lack of confidence, poor communication, inferiority, and superiority behaviors among HCPs were among the mentioned barriers. Shortage of pharmacists, lack of in-job training, standard operating procedures (SOPs), and guidelines were also mentioned. The study noted the high acceptability of CPS by other HCPs, the positive perception of pharmacists, and the recognition of CPS by the Tanzania Pharmacy Act and regulation. CONCLUSION: The facilitators and barriers to the integration of pharmacists in the provision of CPS lie at the individual, health facility, and health system levels. Therefore, the study recommends in-job pharmacists training, fostering teamwork among HCPs, and development of CPS SoPs, and guidelines. BioMed Central 2023-03-17 /pmc/articles/PMC10021921/ /pubmed/36932338 http://dx.doi.org/10.1186/s12875-023-02026-4 Text en © The Author(s) 2023 https://creativecommons.org/licenses/by/4.0/Open AccessThis article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons licence, and indicate if changes were made. The images or other third party material in this article are included in the article's Creative Commons licence, unless indicated otherwise in a credit line to the material. If material is not included in the article's Creative Commons licence and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this licence, visit http://creativecommons.org/licenses/by/4.0/ (https://creativecommons.org/licenses/by/4.0/) . The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/ (https://creativecommons.org/publicdomain/zero/1.0/) ) applies to the data made available in this article, unless otherwise stated in a credit line to the data.
spellingShingle Research
Kilonzi, Manase
Mutagonda, Ritah F.
Mlyuka, Hamu J.
Mwakawanga, Dorkasi L.
Mikomangwa, Wigilya P.
Kibanga, Wema A.
Marealle, Alphonce Ignace
Mallya, Bertha
Katabalo, Deogratias
Sanga, Sofia
Kalokola, Fredrick
Rwegasha, John
Magambo, Rose
Mmassy, John
Kabissi, Sungwa
Balati, Josephine A.
Maduki, Peter
OmaryMashikuMinzi
Kamuhabwa, Appolinary A. R.
Barriers and facilitators of integration of pharmacists in the provision of clinical pharmacy services in Tanzania
title Barriers and facilitators of integration of pharmacists in the provision of clinical pharmacy services in Tanzania
title_full Barriers and facilitators of integration of pharmacists in the provision of clinical pharmacy services in Tanzania
title_fullStr Barriers and facilitators of integration of pharmacists in the provision of clinical pharmacy services in Tanzania
title_full_unstemmed Barriers and facilitators of integration of pharmacists in the provision of clinical pharmacy services in Tanzania
title_short Barriers and facilitators of integration of pharmacists in the provision of clinical pharmacy services in Tanzania
title_sort barriers and facilitators of integration of pharmacists in the provision of clinical pharmacy services in tanzania
topic Research
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10021921/
https://www.ncbi.nlm.nih.gov/pubmed/36932338
http://dx.doi.org/10.1186/s12875-023-02026-4
work_keys_str_mv AT kilonzimanase barriersandfacilitatorsofintegrationofpharmacistsintheprovisionofclinicalpharmacyservicesintanzania
AT mutagondaritahf barriersandfacilitatorsofintegrationofpharmacistsintheprovisionofclinicalpharmacyservicesintanzania
AT mlyukahamuj barriersandfacilitatorsofintegrationofpharmacistsintheprovisionofclinicalpharmacyservicesintanzania
AT mwakawangadorkasil barriersandfacilitatorsofintegrationofpharmacistsintheprovisionofclinicalpharmacyservicesintanzania
AT mikomangwawigilyap barriersandfacilitatorsofintegrationofpharmacistsintheprovisionofclinicalpharmacyservicesintanzania
AT kibangawemaa barriersandfacilitatorsofintegrationofpharmacistsintheprovisionofclinicalpharmacyservicesintanzania
AT mareallealphonceignace barriersandfacilitatorsofintegrationofpharmacistsintheprovisionofclinicalpharmacyservicesintanzania
AT mallyabertha barriersandfacilitatorsofintegrationofpharmacistsintheprovisionofclinicalpharmacyservicesintanzania
AT katabalodeogratias barriersandfacilitatorsofintegrationofpharmacistsintheprovisionofclinicalpharmacyservicesintanzania
AT sangasofia barriersandfacilitatorsofintegrationofpharmacistsintheprovisionofclinicalpharmacyservicesintanzania
AT kalokolafredrick barriersandfacilitatorsofintegrationofpharmacistsintheprovisionofclinicalpharmacyservicesintanzania
AT rwegashajohn barriersandfacilitatorsofintegrationofpharmacistsintheprovisionofclinicalpharmacyservicesintanzania
AT magamborose barriersandfacilitatorsofintegrationofpharmacistsintheprovisionofclinicalpharmacyservicesintanzania
AT mmassyjohn barriersandfacilitatorsofintegrationofpharmacistsintheprovisionofclinicalpharmacyservicesintanzania
AT kabissisungwa barriersandfacilitatorsofintegrationofpharmacistsintheprovisionofclinicalpharmacyservicesintanzania
AT balatijosephinea barriersandfacilitatorsofintegrationofpharmacistsintheprovisionofclinicalpharmacyservicesintanzania
AT madukipeter barriersandfacilitatorsofintegrationofpharmacistsintheprovisionofclinicalpharmacyservicesintanzania
AT omarymashikuminzi barriersandfacilitatorsofintegrationofpharmacistsintheprovisionofclinicalpharmacyservicesintanzania
AT kamuhabwaappolinaryar barriersandfacilitatorsofintegrationofpharmacistsintheprovisionofclinicalpharmacyservicesintanzania