Cargando…
Barriers and facilitators of integration of pharmacists in the provision of clinical pharmacy services in Tanzania
BACKGROUND: Collaboration between medical doctors and nurses in the provision of healthcare services has been there for decades. The concept of clinical pharmacy services as a main goal for pharmacy practice is relatively new and is yielding more positive results for healthcare providers (HCPs), pat...
Autores principales: | , , , , , , , , , , , , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
BioMed Central
2023
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10021921/ https://www.ncbi.nlm.nih.gov/pubmed/36932338 http://dx.doi.org/10.1186/s12875-023-02026-4 |
_version_ | 1784908612683956224 |
---|---|
author | Kilonzi, Manase Mutagonda, Ritah F. Mlyuka, Hamu J. Mwakawanga, Dorkasi L. Mikomangwa, Wigilya P. Kibanga, Wema A. Marealle, Alphonce Ignace Mallya, Bertha Katabalo, Deogratias Sanga, Sofia Kalokola, Fredrick Rwegasha, John Magambo, Rose Mmassy, John Kabissi, Sungwa Balati, Josephine A. Maduki, Peter OmaryMashikuMinzi Kamuhabwa, Appolinary A. R. |
author_facet | Kilonzi, Manase Mutagonda, Ritah F. Mlyuka, Hamu J. Mwakawanga, Dorkasi L. Mikomangwa, Wigilya P. Kibanga, Wema A. Marealle, Alphonce Ignace Mallya, Bertha Katabalo, Deogratias Sanga, Sofia Kalokola, Fredrick Rwegasha, John Magambo, Rose Mmassy, John Kabissi, Sungwa Balati, Josephine A. Maduki, Peter OmaryMashikuMinzi Kamuhabwa, Appolinary A. R. |
author_sort | Kilonzi, Manase |
collection | PubMed |
description | BACKGROUND: Collaboration between medical doctors and nurses in the provision of healthcare services has been there for decades. The concept of clinical pharmacy services as a main goal for pharmacy practice is relatively new and is yielding more positive results for healthcare providers (HCPs), patients, and the health system. This study assessed barriers and facilitators toward the integration of pharmacists in the provision of CPS in Tanzania. METHODS: A qualitative study was conducted in five tertiary hospitals representing Tanzania mainland. Ten (10) focus group discussions (FGDs) with 83 HCPs and 14 in-depth interviews (IDIs) with hospital administrators in referral hospitals were conducted between August and September 2021. The experienced qualitative researchers moderated the IDIs and FGDs, and all discussions were audio-recorded. Finally, the audios were transcribed verbatim, and analysis was done using a thematic approach. RESULTS: Limited skills, lack of confidence, poor communication, inferiority, and superiority behaviors among HCPs were among the mentioned barriers. Shortage of pharmacists, lack of in-job training, standard operating procedures (SOPs), and guidelines were also mentioned. The study noted the high acceptability of CPS by other HCPs, the positive perception of pharmacists, and the recognition of CPS by the Tanzania Pharmacy Act and regulation. CONCLUSION: The facilitators and barriers to the integration of pharmacists in the provision of CPS lie at the individual, health facility, and health system levels. Therefore, the study recommends in-job pharmacists training, fostering teamwork among HCPs, and development of CPS SoPs, and guidelines. |
format | Online Article Text |
id | pubmed-10021921 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2023 |
publisher | BioMed Central |
record_format | MEDLINE/PubMed |
spelling | pubmed-100219212023-03-18 Barriers and facilitators of integration of pharmacists in the provision of clinical pharmacy services in Tanzania Kilonzi, Manase Mutagonda, Ritah F. Mlyuka, Hamu J. Mwakawanga, Dorkasi L. Mikomangwa, Wigilya P. Kibanga, Wema A. Marealle, Alphonce Ignace Mallya, Bertha Katabalo, Deogratias Sanga, Sofia Kalokola, Fredrick Rwegasha, John Magambo, Rose Mmassy, John Kabissi, Sungwa Balati, Josephine A. Maduki, Peter OmaryMashikuMinzi Kamuhabwa, Appolinary A. R. BMC Prim Care Research BACKGROUND: Collaboration between medical doctors and nurses in the provision of healthcare services has been there for decades. The concept of clinical pharmacy services as a main goal for pharmacy practice is relatively new and is yielding more positive results for healthcare providers (HCPs), patients, and the health system. This study assessed barriers and facilitators toward the integration of pharmacists in the provision of CPS in Tanzania. METHODS: A qualitative study was conducted in five tertiary hospitals representing Tanzania mainland. Ten (10) focus group discussions (FGDs) with 83 HCPs and 14 in-depth interviews (IDIs) with hospital administrators in referral hospitals were conducted between August and September 2021. The experienced qualitative researchers moderated the IDIs and FGDs, and all discussions were audio-recorded. Finally, the audios were transcribed verbatim, and analysis was done using a thematic approach. RESULTS: Limited skills, lack of confidence, poor communication, inferiority, and superiority behaviors among HCPs were among the mentioned barriers. Shortage of pharmacists, lack of in-job training, standard operating procedures (SOPs), and guidelines were also mentioned. The study noted the high acceptability of CPS by other HCPs, the positive perception of pharmacists, and the recognition of CPS by the Tanzania Pharmacy Act and regulation. CONCLUSION: The facilitators and barriers to the integration of pharmacists in the provision of CPS lie at the individual, health facility, and health system levels. Therefore, the study recommends in-job pharmacists training, fostering teamwork among HCPs, and development of CPS SoPs, and guidelines. BioMed Central 2023-03-17 /pmc/articles/PMC10021921/ /pubmed/36932338 http://dx.doi.org/10.1186/s12875-023-02026-4 Text en © The Author(s) 2023 https://creativecommons.org/licenses/by/4.0/Open AccessThis article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons licence, and indicate if changes were made. The images or other third party material in this article are included in the article's Creative Commons licence, unless indicated otherwise in a credit line to the material. If material is not included in the article's Creative Commons licence and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this licence, visit http://creativecommons.org/licenses/by/4.0/ (https://creativecommons.org/licenses/by/4.0/) . The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/ (https://creativecommons.org/publicdomain/zero/1.0/) ) applies to the data made available in this article, unless otherwise stated in a credit line to the data. |
spellingShingle | Research Kilonzi, Manase Mutagonda, Ritah F. Mlyuka, Hamu J. Mwakawanga, Dorkasi L. Mikomangwa, Wigilya P. Kibanga, Wema A. Marealle, Alphonce Ignace Mallya, Bertha Katabalo, Deogratias Sanga, Sofia Kalokola, Fredrick Rwegasha, John Magambo, Rose Mmassy, John Kabissi, Sungwa Balati, Josephine A. Maduki, Peter OmaryMashikuMinzi Kamuhabwa, Appolinary A. R. Barriers and facilitators of integration of pharmacists in the provision of clinical pharmacy services in Tanzania |
title | Barriers and facilitators of integration of pharmacists in the provision of clinical pharmacy services in Tanzania |
title_full | Barriers and facilitators of integration of pharmacists in the provision of clinical pharmacy services in Tanzania |
title_fullStr | Barriers and facilitators of integration of pharmacists in the provision of clinical pharmacy services in Tanzania |
title_full_unstemmed | Barriers and facilitators of integration of pharmacists in the provision of clinical pharmacy services in Tanzania |
title_short | Barriers and facilitators of integration of pharmacists in the provision of clinical pharmacy services in Tanzania |
title_sort | barriers and facilitators of integration of pharmacists in the provision of clinical pharmacy services in tanzania |
topic | Research |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10021921/ https://www.ncbi.nlm.nih.gov/pubmed/36932338 http://dx.doi.org/10.1186/s12875-023-02026-4 |
work_keys_str_mv | AT kilonzimanase barriersandfacilitatorsofintegrationofpharmacistsintheprovisionofclinicalpharmacyservicesintanzania AT mutagondaritahf barriersandfacilitatorsofintegrationofpharmacistsintheprovisionofclinicalpharmacyservicesintanzania AT mlyukahamuj barriersandfacilitatorsofintegrationofpharmacistsintheprovisionofclinicalpharmacyservicesintanzania AT mwakawangadorkasil barriersandfacilitatorsofintegrationofpharmacistsintheprovisionofclinicalpharmacyservicesintanzania AT mikomangwawigilyap barriersandfacilitatorsofintegrationofpharmacistsintheprovisionofclinicalpharmacyservicesintanzania AT kibangawemaa barriersandfacilitatorsofintegrationofpharmacistsintheprovisionofclinicalpharmacyservicesintanzania AT mareallealphonceignace barriersandfacilitatorsofintegrationofpharmacistsintheprovisionofclinicalpharmacyservicesintanzania AT mallyabertha barriersandfacilitatorsofintegrationofpharmacistsintheprovisionofclinicalpharmacyservicesintanzania AT katabalodeogratias barriersandfacilitatorsofintegrationofpharmacistsintheprovisionofclinicalpharmacyservicesintanzania AT sangasofia barriersandfacilitatorsofintegrationofpharmacistsintheprovisionofclinicalpharmacyservicesintanzania AT kalokolafredrick barriersandfacilitatorsofintegrationofpharmacistsintheprovisionofclinicalpharmacyservicesintanzania AT rwegashajohn barriersandfacilitatorsofintegrationofpharmacistsintheprovisionofclinicalpharmacyservicesintanzania AT magamborose barriersandfacilitatorsofintegrationofpharmacistsintheprovisionofclinicalpharmacyservicesintanzania AT mmassyjohn barriersandfacilitatorsofintegrationofpharmacistsintheprovisionofclinicalpharmacyservicesintanzania AT kabissisungwa barriersandfacilitatorsofintegrationofpharmacistsintheprovisionofclinicalpharmacyservicesintanzania AT balatijosephinea barriersandfacilitatorsofintegrationofpharmacistsintheprovisionofclinicalpharmacyservicesintanzania AT madukipeter barriersandfacilitatorsofintegrationofpharmacistsintheprovisionofclinicalpharmacyservicesintanzania AT omarymashikuminzi barriersandfacilitatorsofintegrationofpharmacistsintheprovisionofclinicalpharmacyservicesintanzania AT kamuhabwaappolinaryar barriersandfacilitatorsofintegrationofpharmacistsintheprovisionofclinicalpharmacyservicesintanzania |