Cargando…
Correction to: Unexplained visual loss after primary pars-plana-vitrectomy with silicone oil tamponade in fovea-sparing retinal detachment
| Autores principales: | , , , , |
|---|---|
| Formato: | Online Artículo Texto |
| Lenguaje: | English |
| Publicado: |
BioMed Central
2023
|
| Materias: | |
| Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10021961/ https://www.ncbi.nlm.nih.gov/pubmed/36927476 http://dx.doi.org/10.1186/s12886-023-02861-0 |
| _version_ | 1784908621922959360 |
|---|---|
| author | Barth, T. Helbig, H. Maerker, D. Gamulescu, M.-A. Radeck, V. |
| author_facet | Barth, T. Helbig, H. Maerker, D. Gamulescu, M.-A. Radeck, V. |
| author_sort | Barth, T. |
| collection | PubMed |
| description | |
| format | Online Article Text |
| id | pubmed-10021961 |
| institution | National Center for Biotechnology Information |
| language | English |
| publishDate | 2023 |
| publisher | BioMed Central |
| record_format | MEDLINE/PubMed |
| spelling | pubmed-100219612023-03-18 Correction to: Unexplained visual loss after primary pars-plana-vitrectomy with silicone oil tamponade in fovea-sparing retinal detachment Barth, T. Helbig, H. Maerker, D. Gamulescu, M.-A. Radeck, V. BMC Ophthalmol Correction BioMed Central 2023-03-16 /pmc/articles/PMC10021961/ /pubmed/36927476 http://dx.doi.org/10.1186/s12886-023-02861-0 Text en © The Author(s) 2023 https://creativecommons.org/licenses/by/4.0/Open AccessThis article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons licence, and indicate if changes were made. The images or other third party material in this article are included in the article’s Creative Commons licence, unless indicated otherwise in a credit line to the material. If material is not included in the article’s Creative Commons licence and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this licence, visit http://creativecommons.org/licenses/by/4.0/ (https://creativecommons.org/licenses/by/4.0/) . The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/ (https://creativecommons.org/publicdomain/zero/1.0/) ) applies to the data made available in this article, unless otherwise stated in a credit line to the data. |
| spellingShingle | Correction Barth, T. Helbig, H. Maerker, D. Gamulescu, M.-A. Radeck, V. Correction to: Unexplained visual loss after primary pars-plana-vitrectomy with silicone oil tamponade in fovea-sparing retinal detachment |
| title | Correction to: Unexplained visual loss after primary pars-plana-vitrectomy with silicone oil tamponade in fovea-sparing retinal detachment |
| title_full | Correction to: Unexplained visual loss after primary pars-plana-vitrectomy with silicone oil tamponade in fovea-sparing retinal detachment |
| title_fullStr | Correction to: Unexplained visual loss after primary pars-plana-vitrectomy with silicone oil tamponade in fovea-sparing retinal detachment |
| title_full_unstemmed | Correction to: Unexplained visual loss after primary pars-plana-vitrectomy with silicone oil tamponade in fovea-sparing retinal detachment |
| title_short | Correction to: Unexplained visual loss after primary pars-plana-vitrectomy with silicone oil tamponade in fovea-sparing retinal detachment |
| title_sort | correction to: unexplained visual loss after primary pars-plana-vitrectomy with silicone oil tamponade in fovea-sparing retinal detachment |
| topic | Correction |
| url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10021961/ https://www.ncbi.nlm.nih.gov/pubmed/36927476 http://dx.doi.org/10.1186/s12886-023-02861-0 |
| work_keys_str_mv | AT bartht correctiontounexplainedvisuallossafterprimaryparsplanavitrectomywithsiliconeoiltamponadeinfoveasparingretinaldetachment AT helbigh correctiontounexplainedvisuallossafterprimaryparsplanavitrectomywithsiliconeoiltamponadeinfoveasparingretinaldetachment AT maerkerd correctiontounexplainedvisuallossafterprimaryparsplanavitrectomywithsiliconeoiltamponadeinfoveasparingretinaldetachment AT gamulescuma correctiontounexplainedvisuallossafterprimaryparsplanavitrectomywithsiliconeoiltamponadeinfoveasparingretinaldetachment AT radeckv correctiontounexplainedvisuallossafterprimaryparsplanavitrectomywithsiliconeoiltamponadeinfoveasparingretinaldetachment |