Cargando…

360° Diagnostic Tool to Personalize Lifestyle Advice in Primary Care for People With Type 2 Diabetes: Development and Usability Study

BACKGROUND: Various multifaceted factors need to be addressed to improve the health and quality of life of people with type 2 diabetes (T2D). Therefore, we developed a web-based decision support tool that comprises a more holistic diagnosis (including 4 domains: body, thinking and feeling, behavior,...

Descripción completa

Detalles Bibliográficos
Autores principales: Harakeh, Zeena, de Hoogh, Iris M, van Keulen, Hilde, Kalkman, Gino, van Someren, Eugene, van Empelen, Pepijn, Otten, Wilma
Formato: Online Artículo Texto
Lenguaje:English
Publicado: JMIR Publications 2023
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10031445/
https://www.ncbi.nlm.nih.gov/pubmed/36881463
http://dx.doi.org/10.2196/37305
_version_ 1784910607960506368
author Harakeh, Zeena
de Hoogh, Iris M
van Keulen, Hilde
Kalkman, Gino
van Someren, Eugene
van Empelen, Pepijn
Otten, Wilma
author_facet Harakeh, Zeena
de Hoogh, Iris M
van Keulen, Hilde
Kalkman, Gino
van Someren, Eugene
van Empelen, Pepijn
Otten, Wilma
author_sort Harakeh, Zeena
collection PubMed
description BACKGROUND: Various multifaceted factors need to be addressed to improve the health and quality of life of people with type 2 diabetes (T2D). Therefore, we developed a web-based decision support tool that comprises a more holistic diagnosis (including 4 domains: body, thinking and feeling, behavior, and environment) and personalized advice. This 360° diagnostic tool enables people with T2D and health care professionals at the general practice to obtain an overview of the most important T2D-related issues and, subsequently, determine the most suitable intervention for the person with T2D. OBJECTIVE: This study aimed to describe the systematic and iterative development and evaluation of the web-based 360° diagnostic tool. METHODS: We defined the requirements for the web-based 360° diagnostic tool based on previously developed tools, a literature review, and inputs from a multidisciplinary team of experts. As part of the conceptualization, we defined 3 requirements: diagnostics; feedback; and advice, consultation, and follow-up. Next, we developed and designed the content for each of these requirements. We evaluated the diagnostic part of the tool (ie, measurement instruments and visualization) with a qualitative design, in a usability study with a think-aloud strategy and interview questions, among 8 people with T2D at a Dutch general practice. RESULTS: For each of the 4 domains, specific parameters and underlying elements were selected, and measurement instruments (including clinical data and questionnaires) were chosen. Cutoff values were defined to identify high-, middle-, and low-ranking scores, and decision rules were developed and implemented using R scripts and algorithms. A traffic light color visual design was created (profile wheel) to provide an overview of the scores per domain. We mapped the interventions that could be added to the tool and developed a protocol designed as a card deck with motivational interview steps. Furthermore, the usability study showed that people with T2D perceived the tool as easy to use, useful, easy to understand, and insightful. CONCLUSIONS: Preliminary evaluation of the 360° diagnostic tool by experts, health care professionals, and people with T2D showed that the tool was considered relevant, clear, and practical. The iterative process provided insights into the areas of improvement, which were implemented. The strengths, shortcomings, future use, and challenges are also discussed.
format Online
Article
Text
id pubmed-10031445
institution National Center for Biotechnology Information
language English
publishDate 2023
publisher JMIR Publications
record_format MEDLINE/PubMed
spelling pubmed-100314452023-03-23 360° Diagnostic Tool to Personalize Lifestyle Advice in Primary Care for People With Type 2 Diabetes: Development and Usability Study Harakeh, Zeena de Hoogh, Iris M van Keulen, Hilde Kalkman, Gino van Someren, Eugene van Empelen, Pepijn Otten, Wilma JMIR Form Res Original Paper BACKGROUND: Various multifaceted factors need to be addressed to improve the health and quality of life of people with type 2 diabetes (T2D). Therefore, we developed a web-based decision support tool that comprises a more holistic diagnosis (including 4 domains: body, thinking and feeling, behavior, and environment) and personalized advice. This 360° diagnostic tool enables people with T2D and health care professionals at the general practice to obtain an overview of the most important T2D-related issues and, subsequently, determine the most suitable intervention for the person with T2D. OBJECTIVE: This study aimed to describe the systematic and iterative development and evaluation of the web-based 360° diagnostic tool. METHODS: We defined the requirements for the web-based 360° diagnostic tool based on previously developed tools, a literature review, and inputs from a multidisciplinary team of experts. As part of the conceptualization, we defined 3 requirements: diagnostics; feedback; and advice, consultation, and follow-up. Next, we developed and designed the content for each of these requirements. We evaluated the diagnostic part of the tool (ie, measurement instruments and visualization) with a qualitative design, in a usability study with a think-aloud strategy and interview questions, among 8 people with T2D at a Dutch general practice. RESULTS: For each of the 4 domains, specific parameters and underlying elements were selected, and measurement instruments (including clinical data and questionnaires) were chosen. Cutoff values were defined to identify high-, middle-, and low-ranking scores, and decision rules were developed and implemented using R scripts and algorithms. A traffic light color visual design was created (profile wheel) to provide an overview of the scores per domain. We mapped the interventions that could be added to the tool and developed a protocol designed as a card deck with motivational interview steps. Furthermore, the usability study showed that people with T2D perceived the tool as easy to use, useful, easy to understand, and insightful. CONCLUSIONS: Preliminary evaluation of the 360° diagnostic tool by experts, health care professionals, and people with T2D showed that the tool was considered relevant, clear, and practical. The iterative process provided insights into the areas of improvement, which were implemented. The strengths, shortcomings, future use, and challenges are also discussed. JMIR Publications 2023-03-07 /pmc/articles/PMC10031445/ /pubmed/36881463 http://dx.doi.org/10.2196/37305 Text en ©Zeena Harakeh, Iris M de Hoogh, Hilde van Keulen, Gino Kalkman, Eugene van Someren, Pepijn van Empelen, Wilma Otten. Originally published in JMIR Formative Research (https://formative.jmir.org), 07.03.2023. https://creativecommons.org/licenses/by/4.0/This is an open-access article distributed under the terms of the Creative Commons Attribution License (https://creativecommons.org/licenses/by/4.0/), which permits unrestricted use, distribution, and reproduction in any medium, provided the original work, first published in JMIR Formative Research, is properly cited. The complete bibliographic information, a link to the original publication on https://formative.jmir.org, as well as this copyright and license information must be included.
spellingShingle Original Paper
Harakeh, Zeena
de Hoogh, Iris M
van Keulen, Hilde
Kalkman, Gino
van Someren, Eugene
van Empelen, Pepijn
Otten, Wilma
360° Diagnostic Tool to Personalize Lifestyle Advice in Primary Care for People With Type 2 Diabetes: Development and Usability Study
title 360° Diagnostic Tool to Personalize Lifestyle Advice in Primary Care for People With Type 2 Diabetes: Development and Usability Study
title_full 360° Diagnostic Tool to Personalize Lifestyle Advice in Primary Care for People With Type 2 Diabetes: Development and Usability Study
title_fullStr 360° Diagnostic Tool to Personalize Lifestyle Advice in Primary Care for People With Type 2 Diabetes: Development and Usability Study
title_full_unstemmed 360° Diagnostic Tool to Personalize Lifestyle Advice in Primary Care for People With Type 2 Diabetes: Development and Usability Study
title_short 360° Diagnostic Tool to Personalize Lifestyle Advice in Primary Care for People With Type 2 Diabetes: Development and Usability Study
title_sort 360° diagnostic tool to personalize lifestyle advice in primary care for people with type 2 diabetes: development and usability study
topic Original Paper
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10031445/
https://www.ncbi.nlm.nih.gov/pubmed/36881463
http://dx.doi.org/10.2196/37305
work_keys_str_mv AT harakehzeena 360diagnostictooltopersonalizelifestyleadviceinprimarycareforpeoplewithtype2diabetesdevelopmentandusabilitystudy
AT dehooghirism 360diagnostictooltopersonalizelifestyleadviceinprimarycareforpeoplewithtype2diabetesdevelopmentandusabilitystudy
AT vankeulenhilde 360diagnostictooltopersonalizelifestyleadviceinprimarycareforpeoplewithtype2diabetesdevelopmentandusabilitystudy
AT kalkmangino 360diagnostictooltopersonalizelifestyleadviceinprimarycareforpeoplewithtype2diabetesdevelopmentandusabilitystudy
AT vansomereneugene 360diagnostictooltopersonalizelifestyleadviceinprimarycareforpeoplewithtype2diabetesdevelopmentandusabilitystudy
AT vanempelenpepijn 360diagnostictooltopersonalizelifestyleadviceinprimarycareforpeoplewithtype2diabetesdevelopmentandusabilitystudy
AT ottenwilma 360diagnostictooltopersonalizelifestyleadviceinprimarycareforpeoplewithtype2diabetesdevelopmentandusabilitystudy