Cargando…
Identification of the regulatory mechanism of ACE2 in COVID-19–induced kidney damage with systems genetics approach
ABSTRACT: Studies showed that SARS-CoV-2 can directly target the kidney and induce renal damage. As the cell surface receptor for SARS-CoV-2 infection, the angiotensin-converting enzyme 2 (ACE2) plays a pivotal role for renal physiology and function. Thus, it is important to understand ACE2 through...
Autores principales: | , , , , , , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Springer Berlin Heidelberg
2023
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10034233/ https://www.ncbi.nlm.nih.gov/pubmed/36951969 http://dx.doi.org/10.1007/s00109-023-02304-9 |
_version_ | 1784911168000753664 |
---|---|
author | Yang, Xueling Lin, Chunhua Liu, Jian Zhang, Ya Deng, Tingzhi Wei, Mengna Pan, Shuijing Lu, Lu Li, Xuri Tian, Geng Mi, Jia Xu, Fuyi Yang, Chunhua |
author_facet | Yang, Xueling Lin, Chunhua Liu, Jian Zhang, Ya Deng, Tingzhi Wei, Mengna Pan, Shuijing Lu, Lu Li, Xuri Tian, Geng Mi, Jia Xu, Fuyi Yang, Chunhua |
author_sort | Yang, Xueling |
collection | PubMed |
description | ABSTRACT: Studies showed that SARS-CoV-2 can directly target the kidney and induce renal damage. As the cell surface receptor for SARS-CoV-2 infection, the angiotensin-converting enzyme 2 (ACE2) plays a pivotal role for renal physiology and function. Thus, it is important to understand ACE2 through which pathway influences the pathogenesis of renal damage induced by COVID-19. In this study, we first performed an eQTL mapping for Ace2 in kidney tissues in 53 BXD mice strains. Results demonstrated that Ace2 is highly expressed and strongly controlled by a genetic locus on chromosome 16 in the kidney, with six genes (Dnase1, Vasn, Usp7, Abat, Mgrn1, and Rbfox1) dominated as the upstream modulator, as they are highly correlated with Ace2 expression. Gene co-expression analysis showed that Ace2 co-variates are significantly involved in the renin-angiotensin system (RAS) pathway which acts as a reno-protector. Importantly, we also found that Ace2 is positively correlated with Pdgf family members, particularly Pdgfc, which showed the most association among the 76 investigated growth factors. Mammalian Phenotype Ontology enrichment indicated that the cognate transcripts for both Ace2 and Pdgfc were mainly involved in regulating renal physiology and morphology. Among which, Cd44, Egfr, Met, Smad3, and Stat3 were identified as hub genes through protein–protein interaction analysis. Finally, in aligning with our systems genetics findings, we found ACE2, pdgf family members, and RAS genes decreased significantly in the CAKI-1 kidney cancer cells treated with S protein and receptor binding domain structural protein. Collectively, our data suggested that ACE2 work with RAS, PDGFC, as well as their cognate hub genes to regulate renal function, which could guide for future clinical prevention and targeted treatment for COVID-19–induced renal damage outcomes. KEY MESSAGES: • Ace2 is highly expressed and strongly controlled by a genetic locus on chromosome 16 in the kidney. • Ace2 co-variates are enriched in the RAS pathway. • Ace2 is strongly correlated with the growth factor Pdgfc. • Ace2 and Pdgfc co-expressed genes involved in the regulation of renal physiology and morphology. • SARS-CoV-2 spike glycoprotein induces down-regulation of Ace2, RAS, and Pdgfc. SUPPLEMENTARY INFORMATION: The online version contains supplementary material available at 10.1007/s00109-023-02304-9. |
format | Online Article Text |
id | pubmed-10034233 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2023 |
publisher | Springer Berlin Heidelberg |
record_format | MEDLINE/PubMed |
spelling | pubmed-100342332023-03-23 Identification of the regulatory mechanism of ACE2 in COVID-19–induced kidney damage with systems genetics approach Yang, Xueling Lin, Chunhua Liu, Jian Zhang, Ya Deng, Tingzhi Wei, Mengna Pan, Shuijing Lu, Lu Li, Xuri Tian, Geng Mi, Jia Xu, Fuyi Yang, Chunhua J Mol Med (Berl) Original Article ABSTRACT: Studies showed that SARS-CoV-2 can directly target the kidney and induce renal damage. As the cell surface receptor for SARS-CoV-2 infection, the angiotensin-converting enzyme 2 (ACE2) plays a pivotal role for renal physiology and function. Thus, it is important to understand ACE2 through which pathway influences the pathogenesis of renal damage induced by COVID-19. In this study, we first performed an eQTL mapping for Ace2 in kidney tissues in 53 BXD mice strains. Results demonstrated that Ace2 is highly expressed and strongly controlled by a genetic locus on chromosome 16 in the kidney, with six genes (Dnase1, Vasn, Usp7, Abat, Mgrn1, and Rbfox1) dominated as the upstream modulator, as they are highly correlated with Ace2 expression. Gene co-expression analysis showed that Ace2 co-variates are significantly involved in the renin-angiotensin system (RAS) pathway which acts as a reno-protector. Importantly, we also found that Ace2 is positively correlated with Pdgf family members, particularly Pdgfc, which showed the most association among the 76 investigated growth factors. Mammalian Phenotype Ontology enrichment indicated that the cognate transcripts for both Ace2 and Pdgfc were mainly involved in regulating renal physiology and morphology. Among which, Cd44, Egfr, Met, Smad3, and Stat3 were identified as hub genes through protein–protein interaction analysis. Finally, in aligning with our systems genetics findings, we found ACE2, pdgf family members, and RAS genes decreased significantly in the CAKI-1 kidney cancer cells treated with S protein and receptor binding domain structural protein. Collectively, our data suggested that ACE2 work with RAS, PDGFC, as well as their cognate hub genes to regulate renal function, which could guide for future clinical prevention and targeted treatment for COVID-19–induced renal damage outcomes. KEY MESSAGES: • Ace2 is highly expressed and strongly controlled by a genetic locus on chromosome 16 in the kidney. • Ace2 co-variates are enriched in the RAS pathway. • Ace2 is strongly correlated with the growth factor Pdgfc. • Ace2 and Pdgfc co-expressed genes involved in the regulation of renal physiology and morphology. • SARS-CoV-2 spike glycoprotein induces down-regulation of Ace2, RAS, and Pdgfc. SUPPLEMENTARY INFORMATION: The online version contains supplementary material available at 10.1007/s00109-023-02304-9. Springer Berlin Heidelberg 2023-03-23 2023 /pmc/articles/PMC10034233/ /pubmed/36951969 http://dx.doi.org/10.1007/s00109-023-02304-9 Text en © The Author(s), under exclusive licence to Springer-Verlag GmbH Germany, part of Springer Nature 2023, Springer Nature or its licensor (e.g. a society or other partner) holds exclusive rights to this article under a publishing agreement with the author(s) or other rightsholder(s); author self-archiving of the accepted manuscript version of this article is solely governed by the terms of such publishing agreement and applicable law. This article is made available via the PMC Open Access Subset for unrestricted research re-use and secondary analysis in any form or by any means with acknowledgement of the original source. These permissions are granted for the duration of the World Health Organization (WHO) declaration of COVID-19 as a global pandemic. |
spellingShingle | Original Article Yang, Xueling Lin, Chunhua Liu, Jian Zhang, Ya Deng, Tingzhi Wei, Mengna Pan, Shuijing Lu, Lu Li, Xuri Tian, Geng Mi, Jia Xu, Fuyi Yang, Chunhua Identification of the regulatory mechanism of ACE2 in COVID-19–induced kidney damage with systems genetics approach |
title | Identification of the regulatory mechanism of ACE2 in COVID-19–induced kidney damage with systems genetics approach |
title_full | Identification of the regulatory mechanism of ACE2 in COVID-19–induced kidney damage with systems genetics approach |
title_fullStr | Identification of the regulatory mechanism of ACE2 in COVID-19–induced kidney damage with systems genetics approach |
title_full_unstemmed | Identification of the regulatory mechanism of ACE2 in COVID-19–induced kidney damage with systems genetics approach |
title_short | Identification of the regulatory mechanism of ACE2 in COVID-19–induced kidney damage with systems genetics approach |
title_sort | identification of the regulatory mechanism of ace2 in covid-19–induced kidney damage with systems genetics approach |
topic | Original Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10034233/ https://www.ncbi.nlm.nih.gov/pubmed/36951969 http://dx.doi.org/10.1007/s00109-023-02304-9 |
work_keys_str_mv | AT yangxueling identificationoftheregulatorymechanismoface2incovid19inducedkidneydamagewithsystemsgeneticsapproach AT linchunhua identificationoftheregulatorymechanismoface2incovid19inducedkidneydamagewithsystemsgeneticsapproach AT liujian identificationoftheregulatorymechanismoface2incovid19inducedkidneydamagewithsystemsgeneticsapproach AT zhangya identificationoftheregulatorymechanismoface2incovid19inducedkidneydamagewithsystemsgeneticsapproach AT dengtingzhi identificationoftheregulatorymechanismoface2incovid19inducedkidneydamagewithsystemsgeneticsapproach AT weimengna identificationoftheregulatorymechanismoface2incovid19inducedkidneydamagewithsystemsgeneticsapproach AT panshuijing identificationoftheregulatorymechanismoface2incovid19inducedkidneydamagewithsystemsgeneticsapproach AT lulu identificationoftheregulatorymechanismoface2incovid19inducedkidneydamagewithsystemsgeneticsapproach AT lixuri identificationoftheregulatorymechanismoface2incovid19inducedkidneydamagewithsystemsgeneticsapproach AT tiangeng identificationoftheregulatorymechanismoface2incovid19inducedkidneydamagewithsystemsgeneticsapproach AT mijia identificationoftheregulatorymechanismoface2incovid19inducedkidneydamagewithsystemsgeneticsapproach AT xufuyi identificationoftheregulatorymechanismoface2incovid19inducedkidneydamagewithsystemsgeneticsapproach AT yangchunhua identificationoftheregulatorymechanismoface2incovid19inducedkidneydamagewithsystemsgeneticsapproach |