Cargando…

Antipsychotic drugs and their effects on cognitive function: protocol for a systematic review, pairwise, and network meta-analysis

BACKGROUND: There is evidence that antipsychotic drugs differ in their effect on the cognitive symptoms of schizophrenia. So far, there is no comprehensive systematic review available that would enable providers and patients to make informed choices regarding this important aspect of treatment. With...

Descripción completa

Detalles Bibliográficos
Autores principales: Feber, Lena, Peter, Natalie, Schneider-Thoma, Johannes, Siafis, Spyridon, Bighelli, Irene, Hansen, Wulf-Peter, Prates Baldez, Daniel, Salanti, Georgia, Keefe, Richard S. E., Engel, Rolf R., Leucht, Stefan
Formato: Online Artículo Texto
Lenguaje:English
Publicado: BioMed Central 2023
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10037873/
https://www.ncbi.nlm.nih.gov/pubmed/36959619
http://dx.doi.org/10.1186/s13643-023-02213-5
_version_ 1784911967111086080
author Feber, Lena
Peter, Natalie
Schneider-Thoma, Johannes
Siafis, Spyridon
Bighelli, Irene
Hansen, Wulf-Peter
Prates Baldez, Daniel
Salanti, Georgia
Keefe, Richard S. E.
Engel, Rolf R.
Leucht, Stefan
author_facet Feber, Lena
Peter, Natalie
Schneider-Thoma, Johannes
Siafis, Spyridon
Bighelli, Irene
Hansen, Wulf-Peter
Prates Baldez, Daniel
Salanti, Georgia
Keefe, Richard S. E.
Engel, Rolf R.
Leucht, Stefan
author_sort Feber, Lena
collection PubMed
description BACKGROUND: There is evidence that antipsychotic drugs differ in their effect on the cognitive symptoms of schizophrenia. So far, there is no comprehensive systematic review available that would enable providers and patients to make informed choices regarding this important aspect of treatment. With a large number of substances available, conventional pairwise meta-analyses will not be sufficient to inform this choice. To fill this gap, we will conduct a network meta-analysis (NMA), integrating direct and indirect comparisons from randomized controlled trials (RCTs) to rank antipsychotics according to their effect on cognitive functioning. METHODS: In our NMA, we will include RCTs in patients with schizophrenia or schizophrenia-like psychoses comparing one antipsychotic agent with another antipsychotic agent or placebo that measures cognitive function. We will include studies on patients of every age group, in any phase of illness (e.g., acute or stable, first episode or chronic schizophrenia, in- or outpatients) with an intervention time of at least 3 weeks. The primary outcome will be the composite score of cognitive functioning, preferentially measured with the test battery developed by the Measurement and Treatment Research to Improve Cognition in Schizophrenia (MATRICS) initiative. The secondary outcomes include the seven cognitive domains that the composite score is composed of, as well as functioning and quality of life. Study selection and data extraction will be conducted by at least two independent reviewers. We will use the Cochrane Risk of Bias tool 2 to determine the risk of bias in studies, and we will evaluate the confidence in the results using Confidence in Network Meta-Analysis (CINeMA). We will perform NMA using R (package netmeta). We will conduct subgroup and sensitivity analyses to explore the heterogeneity and assess the robustness of our findings. DISCUSSION: This systematic review and network meta-analysis aims to inform evidence-based antipsychotic treatment choice for cognitive deficits in schizophrenia patients by analyzing existing RCTs on this subject. The results have the potential to support patients’ and physicians’ decision-making processes based on the latest available evidence. SYSTEMATIC REVIEW REGISTRATION: PROSPERO CRD42022312483 SUPPLEMENTARY INFORMATION: The online version contains supplementary material available at 10.1186/s13643-023-02213-5.
format Online
Article
Text
id pubmed-10037873
institution National Center for Biotechnology Information
language English
publishDate 2023
publisher BioMed Central
record_format MEDLINE/PubMed
spelling pubmed-100378732023-03-25 Antipsychotic drugs and their effects on cognitive function: protocol for a systematic review, pairwise, and network meta-analysis Feber, Lena Peter, Natalie Schneider-Thoma, Johannes Siafis, Spyridon Bighelli, Irene Hansen, Wulf-Peter Prates Baldez, Daniel Salanti, Georgia Keefe, Richard S. E. Engel, Rolf R. Leucht, Stefan Syst Rev Protocol BACKGROUND: There is evidence that antipsychotic drugs differ in their effect on the cognitive symptoms of schizophrenia. So far, there is no comprehensive systematic review available that would enable providers and patients to make informed choices regarding this important aspect of treatment. With a large number of substances available, conventional pairwise meta-analyses will not be sufficient to inform this choice. To fill this gap, we will conduct a network meta-analysis (NMA), integrating direct and indirect comparisons from randomized controlled trials (RCTs) to rank antipsychotics according to their effect on cognitive functioning. METHODS: In our NMA, we will include RCTs in patients with schizophrenia or schizophrenia-like psychoses comparing one antipsychotic agent with another antipsychotic agent or placebo that measures cognitive function. We will include studies on patients of every age group, in any phase of illness (e.g., acute or stable, first episode or chronic schizophrenia, in- or outpatients) with an intervention time of at least 3 weeks. The primary outcome will be the composite score of cognitive functioning, preferentially measured with the test battery developed by the Measurement and Treatment Research to Improve Cognition in Schizophrenia (MATRICS) initiative. The secondary outcomes include the seven cognitive domains that the composite score is composed of, as well as functioning and quality of life. Study selection and data extraction will be conducted by at least two independent reviewers. We will use the Cochrane Risk of Bias tool 2 to determine the risk of bias in studies, and we will evaluate the confidence in the results using Confidence in Network Meta-Analysis (CINeMA). We will perform NMA using R (package netmeta). We will conduct subgroup and sensitivity analyses to explore the heterogeneity and assess the robustness of our findings. DISCUSSION: This systematic review and network meta-analysis aims to inform evidence-based antipsychotic treatment choice for cognitive deficits in schizophrenia patients by analyzing existing RCTs on this subject. The results have the potential to support patients’ and physicians’ decision-making processes based on the latest available evidence. SYSTEMATIC REVIEW REGISTRATION: PROSPERO CRD42022312483 SUPPLEMENTARY INFORMATION: The online version contains supplementary material available at 10.1186/s13643-023-02213-5. BioMed Central 2023-03-24 /pmc/articles/PMC10037873/ /pubmed/36959619 http://dx.doi.org/10.1186/s13643-023-02213-5 Text en © The Author(s) 2023 https://creativecommons.org/licenses/by/4.0/Open AccessThis article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons licence, and indicate if changes were made. The images or other third party material in this article are included in the article's Creative Commons licence, unless indicated otherwise in a credit line to the material. If material is not included in the article's Creative Commons licence and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this licence, visit http://creativecommons.org/licenses/by/4.0/ (https://creativecommons.org/licenses/by/4.0/) . The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/ (https://creativecommons.org/publicdomain/zero/1.0/) ) applies to the data made available in this article, unless otherwise stated in a credit line to the data.
spellingShingle Protocol
Feber, Lena
Peter, Natalie
Schneider-Thoma, Johannes
Siafis, Spyridon
Bighelli, Irene
Hansen, Wulf-Peter
Prates Baldez, Daniel
Salanti, Georgia
Keefe, Richard S. E.
Engel, Rolf R.
Leucht, Stefan
Antipsychotic drugs and their effects on cognitive function: protocol for a systematic review, pairwise, and network meta-analysis
title Antipsychotic drugs and their effects on cognitive function: protocol for a systematic review, pairwise, and network meta-analysis
title_full Antipsychotic drugs and their effects on cognitive function: protocol for a systematic review, pairwise, and network meta-analysis
title_fullStr Antipsychotic drugs and their effects on cognitive function: protocol for a systematic review, pairwise, and network meta-analysis
title_full_unstemmed Antipsychotic drugs and their effects on cognitive function: protocol for a systematic review, pairwise, and network meta-analysis
title_short Antipsychotic drugs and their effects on cognitive function: protocol for a systematic review, pairwise, and network meta-analysis
title_sort antipsychotic drugs and their effects on cognitive function: protocol for a systematic review, pairwise, and network meta-analysis
topic Protocol
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10037873/
https://www.ncbi.nlm.nih.gov/pubmed/36959619
http://dx.doi.org/10.1186/s13643-023-02213-5
work_keys_str_mv AT feberlena antipsychoticdrugsandtheireffectsoncognitivefunctionprotocolforasystematicreviewpairwiseandnetworkmetaanalysis
AT peternatalie antipsychoticdrugsandtheireffectsoncognitivefunctionprotocolforasystematicreviewpairwiseandnetworkmetaanalysis
AT schneiderthomajohannes antipsychoticdrugsandtheireffectsoncognitivefunctionprotocolforasystematicreviewpairwiseandnetworkmetaanalysis
AT siafisspyridon antipsychoticdrugsandtheireffectsoncognitivefunctionprotocolforasystematicreviewpairwiseandnetworkmetaanalysis
AT bighelliirene antipsychoticdrugsandtheireffectsoncognitivefunctionprotocolforasystematicreviewpairwiseandnetworkmetaanalysis
AT hansenwulfpeter antipsychoticdrugsandtheireffectsoncognitivefunctionprotocolforasystematicreviewpairwiseandnetworkmetaanalysis
AT pratesbaldezdaniel antipsychoticdrugsandtheireffectsoncognitivefunctionprotocolforasystematicreviewpairwiseandnetworkmetaanalysis
AT salantigeorgia antipsychoticdrugsandtheireffectsoncognitivefunctionprotocolforasystematicreviewpairwiseandnetworkmetaanalysis
AT keeferichardse antipsychoticdrugsandtheireffectsoncognitivefunctionprotocolforasystematicreviewpairwiseandnetworkmetaanalysis
AT engelrolfr antipsychoticdrugsandtheireffectsoncognitivefunctionprotocolforasystematicreviewpairwiseandnetworkmetaanalysis
AT leuchtstefan antipsychoticdrugsandtheireffectsoncognitivefunctionprotocolforasystematicreviewpairwiseandnetworkmetaanalysis