Cargando…
Antipsychotic drugs and their effects on cognitive function: protocol for a systematic review, pairwise, and network meta-analysis
BACKGROUND: There is evidence that antipsychotic drugs differ in their effect on the cognitive symptoms of schizophrenia. So far, there is no comprehensive systematic review available that would enable providers and patients to make informed choices regarding this important aspect of treatment. With...
Autores principales: | , , , , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
BioMed Central
2023
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10037873/ https://www.ncbi.nlm.nih.gov/pubmed/36959619 http://dx.doi.org/10.1186/s13643-023-02213-5 |
_version_ | 1784911967111086080 |
---|---|
author | Feber, Lena Peter, Natalie Schneider-Thoma, Johannes Siafis, Spyridon Bighelli, Irene Hansen, Wulf-Peter Prates Baldez, Daniel Salanti, Georgia Keefe, Richard S. E. Engel, Rolf R. Leucht, Stefan |
author_facet | Feber, Lena Peter, Natalie Schneider-Thoma, Johannes Siafis, Spyridon Bighelli, Irene Hansen, Wulf-Peter Prates Baldez, Daniel Salanti, Georgia Keefe, Richard S. E. Engel, Rolf R. Leucht, Stefan |
author_sort | Feber, Lena |
collection | PubMed |
description | BACKGROUND: There is evidence that antipsychotic drugs differ in their effect on the cognitive symptoms of schizophrenia. So far, there is no comprehensive systematic review available that would enable providers and patients to make informed choices regarding this important aspect of treatment. With a large number of substances available, conventional pairwise meta-analyses will not be sufficient to inform this choice. To fill this gap, we will conduct a network meta-analysis (NMA), integrating direct and indirect comparisons from randomized controlled trials (RCTs) to rank antipsychotics according to their effect on cognitive functioning. METHODS: In our NMA, we will include RCTs in patients with schizophrenia or schizophrenia-like psychoses comparing one antipsychotic agent with another antipsychotic agent or placebo that measures cognitive function. We will include studies on patients of every age group, in any phase of illness (e.g., acute or stable, first episode or chronic schizophrenia, in- or outpatients) with an intervention time of at least 3 weeks. The primary outcome will be the composite score of cognitive functioning, preferentially measured with the test battery developed by the Measurement and Treatment Research to Improve Cognition in Schizophrenia (MATRICS) initiative. The secondary outcomes include the seven cognitive domains that the composite score is composed of, as well as functioning and quality of life. Study selection and data extraction will be conducted by at least two independent reviewers. We will use the Cochrane Risk of Bias tool 2 to determine the risk of bias in studies, and we will evaluate the confidence in the results using Confidence in Network Meta-Analysis (CINeMA). We will perform NMA using R (package netmeta). We will conduct subgroup and sensitivity analyses to explore the heterogeneity and assess the robustness of our findings. DISCUSSION: This systematic review and network meta-analysis aims to inform evidence-based antipsychotic treatment choice for cognitive deficits in schizophrenia patients by analyzing existing RCTs on this subject. The results have the potential to support patients’ and physicians’ decision-making processes based on the latest available evidence. SYSTEMATIC REVIEW REGISTRATION: PROSPERO CRD42022312483 SUPPLEMENTARY INFORMATION: The online version contains supplementary material available at 10.1186/s13643-023-02213-5. |
format | Online Article Text |
id | pubmed-10037873 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2023 |
publisher | BioMed Central |
record_format | MEDLINE/PubMed |
spelling | pubmed-100378732023-03-25 Antipsychotic drugs and their effects on cognitive function: protocol for a systematic review, pairwise, and network meta-analysis Feber, Lena Peter, Natalie Schneider-Thoma, Johannes Siafis, Spyridon Bighelli, Irene Hansen, Wulf-Peter Prates Baldez, Daniel Salanti, Georgia Keefe, Richard S. E. Engel, Rolf R. Leucht, Stefan Syst Rev Protocol BACKGROUND: There is evidence that antipsychotic drugs differ in their effect on the cognitive symptoms of schizophrenia. So far, there is no comprehensive systematic review available that would enable providers and patients to make informed choices regarding this important aspect of treatment. With a large number of substances available, conventional pairwise meta-analyses will not be sufficient to inform this choice. To fill this gap, we will conduct a network meta-analysis (NMA), integrating direct and indirect comparisons from randomized controlled trials (RCTs) to rank antipsychotics according to their effect on cognitive functioning. METHODS: In our NMA, we will include RCTs in patients with schizophrenia or schizophrenia-like psychoses comparing one antipsychotic agent with another antipsychotic agent or placebo that measures cognitive function. We will include studies on patients of every age group, in any phase of illness (e.g., acute or stable, first episode or chronic schizophrenia, in- or outpatients) with an intervention time of at least 3 weeks. The primary outcome will be the composite score of cognitive functioning, preferentially measured with the test battery developed by the Measurement and Treatment Research to Improve Cognition in Schizophrenia (MATRICS) initiative. The secondary outcomes include the seven cognitive domains that the composite score is composed of, as well as functioning and quality of life. Study selection and data extraction will be conducted by at least two independent reviewers. We will use the Cochrane Risk of Bias tool 2 to determine the risk of bias in studies, and we will evaluate the confidence in the results using Confidence in Network Meta-Analysis (CINeMA). We will perform NMA using R (package netmeta). We will conduct subgroup and sensitivity analyses to explore the heterogeneity and assess the robustness of our findings. DISCUSSION: This systematic review and network meta-analysis aims to inform evidence-based antipsychotic treatment choice for cognitive deficits in schizophrenia patients by analyzing existing RCTs on this subject. The results have the potential to support patients’ and physicians’ decision-making processes based on the latest available evidence. SYSTEMATIC REVIEW REGISTRATION: PROSPERO CRD42022312483 SUPPLEMENTARY INFORMATION: The online version contains supplementary material available at 10.1186/s13643-023-02213-5. BioMed Central 2023-03-24 /pmc/articles/PMC10037873/ /pubmed/36959619 http://dx.doi.org/10.1186/s13643-023-02213-5 Text en © The Author(s) 2023 https://creativecommons.org/licenses/by/4.0/Open AccessThis article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons licence, and indicate if changes were made. The images or other third party material in this article are included in the article's Creative Commons licence, unless indicated otherwise in a credit line to the material. If material is not included in the article's Creative Commons licence and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this licence, visit http://creativecommons.org/licenses/by/4.0/ (https://creativecommons.org/licenses/by/4.0/) . The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/ (https://creativecommons.org/publicdomain/zero/1.0/) ) applies to the data made available in this article, unless otherwise stated in a credit line to the data. |
spellingShingle | Protocol Feber, Lena Peter, Natalie Schneider-Thoma, Johannes Siafis, Spyridon Bighelli, Irene Hansen, Wulf-Peter Prates Baldez, Daniel Salanti, Georgia Keefe, Richard S. E. Engel, Rolf R. Leucht, Stefan Antipsychotic drugs and their effects on cognitive function: protocol for a systematic review, pairwise, and network meta-analysis |
title | Antipsychotic drugs and their effects on cognitive function: protocol for a systematic review, pairwise, and network meta-analysis |
title_full | Antipsychotic drugs and their effects on cognitive function: protocol for a systematic review, pairwise, and network meta-analysis |
title_fullStr | Antipsychotic drugs and their effects on cognitive function: protocol for a systematic review, pairwise, and network meta-analysis |
title_full_unstemmed | Antipsychotic drugs and their effects on cognitive function: protocol for a systematic review, pairwise, and network meta-analysis |
title_short | Antipsychotic drugs and their effects on cognitive function: protocol for a systematic review, pairwise, and network meta-analysis |
title_sort | antipsychotic drugs and their effects on cognitive function: protocol for a systematic review, pairwise, and network meta-analysis |
topic | Protocol |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10037873/ https://www.ncbi.nlm.nih.gov/pubmed/36959619 http://dx.doi.org/10.1186/s13643-023-02213-5 |
work_keys_str_mv | AT feberlena antipsychoticdrugsandtheireffectsoncognitivefunctionprotocolforasystematicreviewpairwiseandnetworkmetaanalysis AT peternatalie antipsychoticdrugsandtheireffectsoncognitivefunctionprotocolforasystematicreviewpairwiseandnetworkmetaanalysis AT schneiderthomajohannes antipsychoticdrugsandtheireffectsoncognitivefunctionprotocolforasystematicreviewpairwiseandnetworkmetaanalysis AT siafisspyridon antipsychoticdrugsandtheireffectsoncognitivefunctionprotocolforasystematicreviewpairwiseandnetworkmetaanalysis AT bighelliirene antipsychoticdrugsandtheireffectsoncognitivefunctionprotocolforasystematicreviewpairwiseandnetworkmetaanalysis AT hansenwulfpeter antipsychoticdrugsandtheireffectsoncognitivefunctionprotocolforasystematicreviewpairwiseandnetworkmetaanalysis AT pratesbaldezdaniel antipsychoticdrugsandtheireffectsoncognitivefunctionprotocolforasystematicreviewpairwiseandnetworkmetaanalysis AT salantigeorgia antipsychoticdrugsandtheireffectsoncognitivefunctionprotocolforasystematicreviewpairwiseandnetworkmetaanalysis AT keeferichardse antipsychoticdrugsandtheireffectsoncognitivefunctionprotocolforasystematicreviewpairwiseandnetworkmetaanalysis AT engelrolfr antipsychoticdrugsandtheireffectsoncognitivefunctionprotocolforasystematicreviewpairwiseandnetworkmetaanalysis AT leuchtstefan antipsychoticdrugsandtheireffectsoncognitivefunctionprotocolforasystematicreviewpairwiseandnetworkmetaanalysis |