Cargando…

Effects of Citrus kawachiensis Peel in Frailty-like Model Mice Induced by Low Protein Nutrition Disorders

“Frailty” caused by a decline in physiological reserve capacity, chronic inflammation, and oxidative stress in the elderly has recently become a major social issue. The present study examined the effects of the peel of Citrus kawachiensis (CK), which exhibits anti-inflammatory, antioxidant, and pro-...

Descripción completa

Detalles Bibliográficos
Autores principales: Omasa, Toshiki, Okuyama, Satoshi, Sawamoto, Atsushi, Nakajima, Mitsunari, Furukawa, Yoshiko
Formato: Online Artículo Texto
Lenguaje:English
Publicado: MDPI 2023
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10045201/
https://www.ncbi.nlm.nih.gov/pubmed/36979027
http://dx.doi.org/10.3390/antiox12030779
_version_ 1784913543691239424
author Omasa, Toshiki
Okuyama, Satoshi
Sawamoto, Atsushi
Nakajima, Mitsunari
Furukawa, Yoshiko
author_facet Omasa, Toshiki
Okuyama, Satoshi
Sawamoto, Atsushi
Nakajima, Mitsunari
Furukawa, Yoshiko
author_sort Omasa, Toshiki
collection PubMed
description “Frailty” caused by a decline in physiological reserve capacity, chronic inflammation, and oxidative stress in the elderly has recently become a major social issue. The present study examined the effects of the peel of Citrus kawachiensis (CK), which exhibits anti-inflammatory, antioxidant, and pro-neurogenesis activities in frailty-like model mice. Male C57BL/6 mice (15 weeks old) were fed an 18% protein diet (CON), a 2.5% protein diet (PM), and PM mixed with 1% dried CK peel powder for approximately 1 month. Mice were euthanized 2 or 8 days after a single intraperitoneal administration of lipopolysaccharide (LPS) and tissues were dissected. Among peripheral tissues, muscle weight, liver weight, and blood glucose levels were significantly higher in the PM–LPS–CK group than in the PM–LPS group. In the behavioral analysis, locomotive activity was significantly lower in the PM–LPS group than in the PM group. The reduction in locomotive activity in the PM–LPS–CK group was significantly smaller than that in the PM–LPS group. The quantification of microglia in the hippocampal stratum lacunosum-moleculare revealed that increases in the PM–LPS group were significantly suppressed by the dried CK peel powder. Furthermore, the quantification of synaptic vesicle membrane proteins in the hippocampal CA3 region showed down-regulated expression in the PM–LPS group, which was significantly ameliorated by the administration of the dried CK peel powder. Collectively, these results suggest that CK inhibits inflammation and oxidative stress induced by PM and LPS in the central nervous system and peripheral tissue. Therefore, C. kawachiensis is highly effective against “frailty”.
format Online
Article
Text
id pubmed-10045201
institution National Center for Biotechnology Information
language English
publishDate 2023
publisher MDPI
record_format MEDLINE/PubMed
spelling pubmed-100452012023-03-29 Effects of Citrus kawachiensis Peel in Frailty-like Model Mice Induced by Low Protein Nutrition Disorders Omasa, Toshiki Okuyama, Satoshi Sawamoto, Atsushi Nakajima, Mitsunari Furukawa, Yoshiko Antioxidants (Basel) Article “Frailty” caused by a decline in physiological reserve capacity, chronic inflammation, and oxidative stress in the elderly has recently become a major social issue. The present study examined the effects of the peel of Citrus kawachiensis (CK), which exhibits anti-inflammatory, antioxidant, and pro-neurogenesis activities in frailty-like model mice. Male C57BL/6 mice (15 weeks old) were fed an 18% protein diet (CON), a 2.5% protein diet (PM), and PM mixed with 1% dried CK peel powder for approximately 1 month. Mice were euthanized 2 or 8 days after a single intraperitoneal administration of lipopolysaccharide (LPS) and tissues were dissected. Among peripheral tissues, muscle weight, liver weight, and blood glucose levels were significantly higher in the PM–LPS–CK group than in the PM–LPS group. In the behavioral analysis, locomotive activity was significantly lower in the PM–LPS group than in the PM group. The reduction in locomotive activity in the PM–LPS–CK group was significantly smaller than that in the PM–LPS group. The quantification of microglia in the hippocampal stratum lacunosum-moleculare revealed that increases in the PM–LPS group were significantly suppressed by the dried CK peel powder. Furthermore, the quantification of synaptic vesicle membrane proteins in the hippocampal CA3 region showed down-regulated expression in the PM–LPS group, which was significantly ameliorated by the administration of the dried CK peel powder. Collectively, these results suggest that CK inhibits inflammation and oxidative stress induced by PM and LPS in the central nervous system and peripheral tissue. Therefore, C. kawachiensis is highly effective against “frailty”. MDPI 2023-03-22 /pmc/articles/PMC10045201/ /pubmed/36979027 http://dx.doi.org/10.3390/antiox12030779 Text en © 2023 by the authors. https://creativecommons.org/licenses/by/4.0/Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (https://creativecommons.org/licenses/by/4.0/).
spellingShingle Article
Omasa, Toshiki
Okuyama, Satoshi
Sawamoto, Atsushi
Nakajima, Mitsunari
Furukawa, Yoshiko
Effects of Citrus kawachiensis Peel in Frailty-like Model Mice Induced by Low Protein Nutrition Disorders
title Effects of Citrus kawachiensis Peel in Frailty-like Model Mice Induced by Low Protein Nutrition Disorders
title_full Effects of Citrus kawachiensis Peel in Frailty-like Model Mice Induced by Low Protein Nutrition Disorders
title_fullStr Effects of Citrus kawachiensis Peel in Frailty-like Model Mice Induced by Low Protein Nutrition Disorders
title_full_unstemmed Effects of Citrus kawachiensis Peel in Frailty-like Model Mice Induced by Low Protein Nutrition Disorders
title_short Effects of Citrus kawachiensis Peel in Frailty-like Model Mice Induced by Low Protein Nutrition Disorders
title_sort effects of citrus kawachiensis peel in frailty-like model mice induced by low protein nutrition disorders
topic Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10045201/
https://www.ncbi.nlm.nih.gov/pubmed/36979027
http://dx.doi.org/10.3390/antiox12030779
work_keys_str_mv AT omasatoshiki effectsofcitruskawachiensispeelinfrailtylikemodelmiceinducedbylowproteinnutritiondisorders
AT okuyamasatoshi effectsofcitruskawachiensispeelinfrailtylikemodelmiceinducedbylowproteinnutritiondisorders
AT sawamotoatsushi effectsofcitruskawachiensispeelinfrailtylikemodelmiceinducedbylowproteinnutritiondisorders
AT nakajimamitsunari effectsofcitruskawachiensispeelinfrailtylikemodelmiceinducedbylowproteinnutritiondisorders
AT furukawayoshiko effectsofcitruskawachiensispeelinfrailtylikemodelmiceinducedbylowproteinnutritiondisorders