Cargando…

Molecular Mechanisms of the Melatonin Receptor Pathway Linking Circadian Rhythm to Type 2 Diabetes Mellitus

Night-shift work and sleep disorders are associated with type 2 diabetes (T2DM), and circadian rhythm disruption is intrinsically involved. Studies have identified several signaling pathways that separately link two melatonin receptors (MT(1) and MT(2)) to insulin secretion and T2DM occurrence, but...

Descripción completa

Detalles Bibliográficos
Autores principales: Xia, An-Yu, Zhu, Hui, Zhao, Zhi-Jia, Liu, Hong-Yi, Wang, Peng-Hao, Ji, Lin-Dan, Xu, Jin
Formato: Online Artículo Texto
Lenguaje:English
Publicado: MDPI 2023
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10052080/
https://www.ncbi.nlm.nih.gov/pubmed/36986139
http://dx.doi.org/10.3390/nu15061406
_version_ 1785015063870963712
author Xia, An-Yu
Zhu, Hui
Zhao, Zhi-Jia
Liu, Hong-Yi
Wang, Peng-Hao
Ji, Lin-Dan
Xu, Jin
author_facet Xia, An-Yu
Zhu, Hui
Zhao, Zhi-Jia
Liu, Hong-Yi
Wang, Peng-Hao
Ji, Lin-Dan
Xu, Jin
author_sort Xia, An-Yu
collection PubMed
description Night-shift work and sleep disorders are associated with type 2 diabetes (T2DM), and circadian rhythm disruption is intrinsically involved. Studies have identified several signaling pathways that separately link two melatonin receptors (MT(1) and MT(2)) to insulin secretion and T2DM occurrence, but a comprehensive explanation of the molecular mechanism to elucidate the association between these receptors to T2DM, reasonably and precisely, has been lacking. This review thoroughly explicates the signaling system, which consists of four important pathways, linking melatonin receptors MT(1) or MT(2) to insulin secretion. Then, the association of the circadian rhythm with MTNR1B transcription is extensively expounded. Finally, a concrete molecular and evolutionary mechanism underlying the macroscopic association between the circadian rhythm and T2DM is established. This review provides new insights into the pathology, treatment, and prevention of T2DM.
format Online
Article
Text
id pubmed-10052080
institution National Center for Biotechnology Information
language English
publishDate 2023
publisher MDPI
record_format MEDLINE/PubMed
spelling pubmed-100520802023-03-30 Molecular Mechanisms of the Melatonin Receptor Pathway Linking Circadian Rhythm to Type 2 Diabetes Mellitus Xia, An-Yu Zhu, Hui Zhao, Zhi-Jia Liu, Hong-Yi Wang, Peng-Hao Ji, Lin-Dan Xu, Jin Nutrients Review Night-shift work and sleep disorders are associated with type 2 diabetes (T2DM), and circadian rhythm disruption is intrinsically involved. Studies have identified several signaling pathways that separately link two melatonin receptors (MT(1) and MT(2)) to insulin secretion and T2DM occurrence, but a comprehensive explanation of the molecular mechanism to elucidate the association between these receptors to T2DM, reasonably and precisely, has been lacking. This review thoroughly explicates the signaling system, which consists of four important pathways, linking melatonin receptors MT(1) or MT(2) to insulin secretion. Then, the association of the circadian rhythm with MTNR1B transcription is extensively expounded. Finally, a concrete molecular and evolutionary mechanism underlying the macroscopic association between the circadian rhythm and T2DM is established. This review provides new insights into the pathology, treatment, and prevention of T2DM. MDPI 2023-03-15 /pmc/articles/PMC10052080/ /pubmed/36986139 http://dx.doi.org/10.3390/nu15061406 Text en © 2023 by the authors. https://creativecommons.org/licenses/by/4.0/Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (https://creativecommons.org/licenses/by/4.0/).
spellingShingle Review
Xia, An-Yu
Zhu, Hui
Zhao, Zhi-Jia
Liu, Hong-Yi
Wang, Peng-Hao
Ji, Lin-Dan
Xu, Jin
Molecular Mechanisms of the Melatonin Receptor Pathway Linking Circadian Rhythm to Type 2 Diabetes Mellitus
title Molecular Mechanisms of the Melatonin Receptor Pathway Linking Circadian Rhythm to Type 2 Diabetes Mellitus
title_full Molecular Mechanisms of the Melatonin Receptor Pathway Linking Circadian Rhythm to Type 2 Diabetes Mellitus
title_fullStr Molecular Mechanisms of the Melatonin Receptor Pathway Linking Circadian Rhythm to Type 2 Diabetes Mellitus
title_full_unstemmed Molecular Mechanisms of the Melatonin Receptor Pathway Linking Circadian Rhythm to Type 2 Diabetes Mellitus
title_short Molecular Mechanisms of the Melatonin Receptor Pathway Linking Circadian Rhythm to Type 2 Diabetes Mellitus
title_sort molecular mechanisms of the melatonin receptor pathway linking circadian rhythm to type 2 diabetes mellitus
topic Review
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10052080/
https://www.ncbi.nlm.nih.gov/pubmed/36986139
http://dx.doi.org/10.3390/nu15061406
work_keys_str_mv AT xiaanyu molecularmechanismsofthemelatoninreceptorpathwaylinkingcircadianrhythmtotype2diabetesmellitus
AT zhuhui molecularmechanismsofthemelatoninreceptorpathwaylinkingcircadianrhythmtotype2diabetesmellitus
AT zhaozhijia molecularmechanismsofthemelatoninreceptorpathwaylinkingcircadianrhythmtotype2diabetesmellitus
AT liuhongyi molecularmechanismsofthemelatoninreceptorpathwaylinkingcircadianrhythmtotype2diabetesmellitus
AT wangpenghao molecularmechanismsofthemelatoninreceptorpathwaylinkingcircadianrhythmtotype2diabetesmellitus
AT jilindan molecularmechanismsofthemelatoninreceptorpathwaylinkingcircadianrhythmtotype2diabetesmellitus
AT xujin molecularmechanismsofthemelatoninreceptorpathwaylinkingcircadianrhythmtotype2diabetesmellitus