Cargando…
Molecular Mechanisms of the Melatonin Receptor Pathway Linking Circadian Rhythm to Type 2 Diabetes Mellitus
Night-shift work and sleep disorders are associated with type 2 diabetes (T2DM), and circadian rhythm disruption is intrinsically involved. Studies have identified several signaling pathways that separately link two melatonin receptors (MT(1) and MT(2)) to insulin secretion and T2DM occurrence, but...
Autores principales: | , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
MDPI
2023
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10052080/ https://www.ncbi.nlm.nih.gov/pubmed/36986139 http://dx.doi.org/10.3390/nu15061406 |
_version_ | 1785015063870963712 |
---|---|
author | Xia, An-Yu Zhu, Hui Zhao, Zhi-Jia Liu, Hong-Yi Wang, Peng-Hao Ji, Lin-Dan Xu, Jin |
author_facet | Xia, An-Yu Zhu, Hui Zhao, Zhi-Jia Liu, Hong-Yi Wang, Peng-Hao Ji, Lin-Dan Xu, Jin |
author_sort | Xia, An-Yu |
collection | PubMed |
description | Night-shift work and sleep disorders are associated with type 2 diabetes (T2DM), and circadian rhythm disruption is intrinsically involved. Studies have identified several signaling pathways that separately link two melatonin receptors (MT(1) and MT(2)) to insulin secretion and T2DM occurrence, but a comprehensive explanation of the molecular mechanism to elucidate the association between these receptors to T2DM, reasonably and precisely, has been lacking. This review thoroughly explicates the signaling system, which consists of four important pathways, linking melatonin receptors MT(1) or MT(2) to insulin secretion. Then, the association of the circadian rhythm with MTNR1B transcription is extensively expounded. Finally, a concrete molecular and evolutionary mechanism underlying the macroscopic association between the circadian rhythm and T2DM is established. This review provides new insights into the pathology, treatment, and prevention of T2DM. |
format | Online Article Text |
id | pubmed-10052080 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2023 |
publisher | MDPI |
record_format | MEDLINE/PubMed |
spelling | pubmed-100520802023-03-30 Molecular Mechanisms of the Melatonin Receptor Pathway Linking Circadian Rhythm to Type 2 Diabetes Mellitus Xia, An-Yu Zhu, Hui Zhao, Zhi-Jia Liu, Hong-Yi Wang, Peng-Hao Ji, Lin-Dan Xu, Jin Nutrients Review Night-shift work and sleep disorders are associated with type 2 diabetes (T2DM), and circadian rhythm disruption is intrinsically involved. Studies have identified several signaling pathways that separately link two melatonin receptors (MT(1) and MT(2)) to insulin secretion and T2DM occurrence, but a comprehensive explanation of the molecular mechanism to elucidate the association between these receptors to T2DM, reasonably and precisely, has been lacking. This review thoroughly explicates the signaling system, which consists of four important pathways, linking melatonin receptors MT(1) or MT(2) to insulin secretion. Then, the association of the circadian rhythm with MTNR1B transcription is extensively expounded. Finally, a concrete molecular and evolutionary mechanism underlying the macroscopic association between the circadian rhythm and T2DM is established. This review provides new insights into the pathology, treatment, and prevention of T2DM. MDPI 2023-03-15 /pmc/articles/PMC10052080/ /pubmed/36986139 http://dx.doi.org/10.3390/nu15061406 Text en © 2023 by the authors. https://creativecommons.org/licenses/by/4.0/Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (https://creativecommons.org/licenses/by/4.0/). |
spellingShingle | Review Xia, An-Yu Zhu, Hui Zhao, Zhi-Jia Liu, Hong-Yi Wang, Peng-Hao Ji, Lin-Dan Xu, Jin Molecular Mechanisms of the Melatonin Receptor Pathway Linking Circadian Rhythm to Type 2 Diabetes Mellitus |
title | Molecular Mechanisms of the Melatonin Receptor Pathway Linking Circadian Rhythm to Type 2 Diabetes Mellitus |
title_full | Molecular Mechanisms of the Melatonin Receptor Pathway Linking Circadian Rhythm to Type 2 Diabetes Mellitus |
title_fullStr | Molecular Mechanisms of the Melatonin Receptor Pathway Linking Circadian Rhythm to Type 2 Diabetes Mellitus |
title_full_unstemmed | Molecular Mechanisms of the Melatonin Receptor Pathway Linking Circadian Rhythm to Type 2 Diabetes Mellitus |
title_short | Molecular Mechanisms of the Melatonin Receptor Pathway Linking Circadian Rhythm to Type 2 Diabetes Mellitus |
title_sort | molecular mechanisms of the melatonin receptor pathway linking circadian rhythm to type 2 diabetes mellitus |
topic | Review |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10052080/ https://www.ncbi.nlm.nih.gov/pubmed/36986139 http://dx.doi.org/10.3390/nu15061406 |
work_keys_str_mv | AT xiaanyu molecularmechanismsofthemelatoninreceptorpathwaylinkingcircadianrhythmtotype2diabetesmellitus AT zhuhui molecularmechanismsofthemelatoninreceptorpathwaylinkingcircadianrhythmtotype2diabetesmellitus AT zhaozhijia molecularmechanismsofthemelatoninreceptorpathwaylinkingcircadianrhythmtotype2diabetesmellitus AT liuhongyi molecularmechanismsofthemelatoninreceptorpathwaylinkingcircadianrhythmtotype2diabetesmellitus AT wangpenghao molecularmechanismsofthemelatoninreceptorpathwaylinkingcircadianrhythmtotype2diabetesmellitus AT jilindan molecularmechanismsofthemelatoninreceptorpathwaylinkingcircadianrhythmtotype2diabetesmellitus AT xujin molecularmechanismsofthemelatoninreceptorpathwaylinkingcircadianrhythmtotype2diabetesmellitus |