Cargando…
Correction to: Phospho-heavy-labeled-spiketide FAIMS stepped-CV DDA (pHASED) provides real-time phosphoproteomics data to aid in cancer drug selection
| Autores principales: | , , , , , , , , , , , , , , , , , |
|---|---|
| Formato: | Online Artículo Texto |
| Lenguaje: | English |
| Publicado: |
BioMed Central
2023
|
| Materias: | |
| Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10082522/ https://www.ncbi.nlm.nih.gov/pubmed/37031204 http://dx.doi.org/10.1186/s12014-023-09406-z |
| _version_ | 1785021330390777856 |
|---|---|
| author | Staudt, Dilana E. Murray, Heather C. Skerrett-Byrne, David A. Smith, Nathan D. Jamaluddin, M. Fairuz B. Kahl, Richard G. S. Duchatel, Ryan J. Germon, Zacary P. McLachlan, Tabitha Jackson, Evangeline R. Findlay, Izac J. Kearney, Padraic S. Mannan, Abdul McEwen, Holly P. Douglas, Alicia M. Nixon, Brett Verrills, Nicole M. Dun, Matthew D. |
| author_facet | Staudt, Dilana E. Murray, Heather C. Skerrett-Byrne, David A. Smith, Nathan D. Jamaluddin, M. Fairuz B. Kahl, Richard G. S. Duchatel, Ryan J. Germon, Zacary P. McLachlan, Tabitha Jackson, Evangeline R. Findlay, Izac J. Kearney, Padraic S. Mannan, Abdul McEwen, Holly P. Douglas, Alicia M. Nixon, Brett Verrills, Nicole M. Dun, Matthew D. |
| author_sort | Staudt, Dilana E. |
| collection | PubMed |
| description | |
| format | Online Article Text |
| id | pubmed-10082522 |
| institution | National Center for Biotechnology Information |
| language | English |
| publishDate | 2023 |
| publisher | BioMed Central |
| record_format | MEDLINE/PubMed |
| spelling | pubmed-100825222023-04-09 Correction to: Phospho-heavy-labeled-spiketide FAIMS stepped-CV DDA (pHASED) provides real-time phosphoproteomics data to aid in cancer drug selection Staudt, Dilana E. Murray, Heather C. Skerrett-Byrne, David A. Smith, Nathan D. Jamaluddin, M. Fairuz B. Kahl, Richard G. S. Duchatel, Ryan J. Germon, Zacary P. McLachlan, Tabitha Jackson, Evangeline R. Findlay, Izac J. Kearney, Padraic S. Mannan, Abdul McEwen, Holly P. Douglas, Alicia M. Nixon, Brett Verrills, Nicole M. Dun, Matthew D. Clin Proteomics Correction BioMed Central 2023-04-08 /pmc/articles/PMC10082522/ /pubmed/37031204 http://dx.doi.org/10.1186/s12014-023-09406-z Text en © The Author(s) 2023 https://creativecommons.org/licenses/by/4.0/Open AccessThis article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons licence, and indicate if changes were made. The images or other third party material in this article are included in the article's Creative Commons licence, unless indicated otherwise in a credit line to the material. If material is not included in the article's Creative Commons licence and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this licence, visit http://creativecommons.org/licenses/by/4.0/ (https://creativecommons.org/licenses/by/4.0/) . The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/ (https://creativecommons.org/publicdomain/zero/1.0/) ) applies to the data made available in this article, unless otherwise stated in a credit line to the data. |
| spellingShingle | Correction Staudt, Dilana E. Murray, Heather C. Skerrett-Byrne, David A. Smith, Nathan D. Jamaluddin, M. Fairuz B. Kahl, Richard G. S. Duchatel, Ryan J. Germon, Zacary P. McLachlan, Tabitha Jackson, Evangeline R. Findlay, Izac J. Kearney, Padraic S. Mannan, Abdul McEwen, Holly P. Douglas, Alicia M. Nixon, Brett Verrills, Nicole M. Dun, Matthew D. Correction to: Phospho-heavy-labeled-spiketide FAIMS stepped-CV DDA (pHASED) provides real-time phosphoproteomics data to aid in cancer drug selection |
| title | Correction to: Phospho-heavy-labeled-spiketide FAIMS stepped-CV DDA (pHASED) provides real-time phosphoproteomics data to aid in cancer drug selection |
| title_full | Correction to: Phospho-heavy-labeled-spiketide FAIMS stepped-CV DDA (pHASED) provides real-time phosphoproteomics data to aid in cancer drug selection |
| title_fullStr | Correction to: Phospho-heavy-labeled-spiketide FAIMS stepped-CV DDA (pHASED) provides real-time phosphoproteomics data to aid in cancer drug selection |
| title_full_unstemmed | Correction to: Phospho-heavy-labeled-spiketide FAIMS stepped-CV DDA (pHASED) provides real-time phosphoproteomics data to aid in cancer drug selection |
| title_short | Correction to: Phospho-heavy-labeled-spiketide FAIMS stepped-CV DDA (pHASED) provides real-time phosphoproteomics data to aid in cancer drug selection |
| title_sort | correction to: phospho-heavy-labeled-spiketide faims stepped-cv dda (phased) provides real-time phosphoproteomics data to aid in cancer drug selection |
| topic | Correction |
| url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10082522/ https://www.ncbi.nlm.nih.gov/pubmed/37031204 http://dx.doi.org/10.1186/s12014-023-09406-z |
| work_keys_str_mv | AT staudtdilanae correctiontophosphoheavylabeledspiketidefaimssteppedcvddaphasedprovidesrealtimephosphoproteomicsdatatoaidincancerdrugselection AT murrayheatherc correctiontophosphoheavylabeledspiketidefaimssteppedcvddaphasedprovidesrealtimephosphoproteomicsdatatoaidincancerdrugselection AT skerrettbyrnedavida correctiontophosphoheavylabeledspiketidefaimssteppedcvddaphasedprovidesrealtimephosphoproteomicsdatatoaidincancerdrugselection AT smithnathand correctiontophosphoheavylabeledspiketidefaimssteppedcvddaphasedprovidesrealtimephosphoproteomicsdatatoaidincancerdrugselection AT jamaluddinmfairuzb correctiontophosphoheavylabeledspiketidefaimssteppedcvddaphasedprovidesrealtimephosphoproteomicsdatatoaidincancerdrugselection AT kahlrichardgs correctiontophosphoheavylabeledspiketidefaimssteppedcvddaphasedprovidesrealtimephosphoproteomicsdatatoaidincancerdrugselection AT duchatelryanj correctiontophosphoheavylabeledspiketidefaimssteppedcvddaphasedprovidesrealtimephosphoproteomicsdatatoaidincancerdrugselection AT germonzacaryp correctiontophosphoheavylabeledspiketidefaimssteppedcvddaphasedprovidesrealtimephosphoproteomicsdatatoaidincancerdrugselection AT mclachlantabitha correctiontophosphoheavylabeledspiketidefaimssteppedcvddaphasedprovidesrealtimephosphoproteomicsdatatoaidincancerdrugselection AT jacksonevangeliner correctiontophosphoheavylabeledspiketidefaimssteppedcvddaphasedprovidesrealtimephosphoproteomicsdatatoaidincancerdrugselection AT findlayizacj correctiontophosphoheavylabeledspiketidefaimssteppedcvddaphasedprovidesrealtimephosphoproteomicsdatatoaidincancerdrugselection AT kearneypadraics correctiontophosphoheavylabeledspiketidefaimssteppedcvddaphasedprovidesrealtimephosphoproteomicsdatatoaidincancerdrugselection AT mannanabdul correctiontophosphoheavylabeledspiketidefaimssteppedcvddaphasedprovidesrealtimephosphoproteomicsdatatoaidincancerdrugselection AT mcewenhollyp correctiontophosphoheavylabeledspiketidefaimssteppedcvddaphasedprovidesrealtimephosphoproteomicsdatatoaidincancerdrugselection AT douglasaliciam correctiontophosphoheavylabeledspiketidefaimssteppedcvddaphasedprovidesrealtimephosphoproteomicsdatatoaidincancerdrugselection AT nixonbrett correctiontophosphoheavylabeledspiketidefaimssteppedcvddaphasedprovidesrealtimephosphoproteomicsdatatoaidincancerdrugselection AT verrillsnicolem correctiontophosphoheavylabeledspiketidefaimssteppedcvddaphasedprovidesrealtimephosphoproteomicsdatatoaidincancerdrugselection AT dunmatthewd correctiontophosphoheavylabeledspiketidefaimssteppedcvddaphasedprovidesrealtimephosphoproteomicsdatatoaidincancerdrugselection |