Cargando…
Novel V-shaped kiss flap harvest technique for the forearm free flap in soft tissue reconstruction
INTRODUCTION: Radial forearm flap (RFF) is widely used in oral reconstruction. However, the donor-site defect remains the main limit. In this paper, V-shaped kiss RFF (VRFF) is described as a novel technique to improve aesthetics and function of it. A retrospective study was conducted to introduce V...
Autores principales: | , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
BioMed Central
2023
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10084695/ https://www.ncbi.nlm.nih.gov/pubmed/37032354 http://dx.doi.org/10.1186/s12957-023-02989-9 |
_version_ | 1785021793956790272 |
---|---|
author | Zhao, Wenquan Zhu, Wenyuan Yu, Dan Zhu, Huiyong Liu, Jianhua Ni, Youkang |
author_facet | Zhao, Wenquan Zhu, Wenyuan Yu, Dan Zhu, Huiyong Liu, Jianhua Ni, Youkang |
author_sort | Zhao, Wenquan |
collection | PubMed |
description | INTRODUCTION: Radial forearm flap (RFF) is widely used in oral reconstruction. However, the donor-site defect remains the main limit. In this paper, V-shaped kiss RFF (VRFF) is described as a novel technique to improve aesthetics and function of it. A retrospective study was conducted to introduce VRFF and evaluate its effect and safety. METHODS: A total of 21 patients who underwent VRFF for oral reconstruction, and 23 patients who underwent conventional RFF from February 2016 to April 2018 were included in this study. Direct comparisons were made on patient’s subjective evaluation of postoperative hand function and degree of scarring and objective donor-site function assessment including range of wrist movements and grip strength before and after surgery between the two groups. RESULTS: No skin grafts were used in the VRFF group, and 20 of 21 patients achieved primary healing at donor site, while all patients from the RFF group had skin grafts. And 18 of 23 patients achieved primary healing. The postoperative scar score of donor site in the VRFF group was significantly higher than that in the RFF group (3.4 vs 2.8, P = 0.035). There were no significant differences in other subjective evaluation and donor-site morbidity and hand function assessment. CONCLUSION: VRFF is able to provide a new and simple method to close donor-site defect and realize a better healing in donor site. |
format | Online Article Text |
id | pubmed-10084695 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2023 |
publisher | BioMed Central |
record_format | MEDLINE/PubMed |
spelling | pubmed-100846952023-04-11 Novel V-shaped kiss flap harvest technique for the forearm free flap in soft tissue reconstruction Zhao, Wenquan Zhu, Wenyuan Yu, Dan Zhu, Huiyong Liu, Jianhua Ni, Youkang World J Surg Oncol Research INTRODUCTION: Radial forearm flap (RFF) is widely used in oral reconstruction. However, the donor-site defect remains the main limit. In this paper, V-shaped kiss RFF (VRFF) is described as a novel technique to improve aesthetics and function of it. A retrospective study was conducted to introduce VRFF and evaluate its effect and safety. METHODS: A total of 21 patients who underwent VRFF for oral reconstruction, and 23 patients who underwent conventional RFF from February 2016 to April 2018 were included in this study. Direct comparisons were made on patient’s subjective evaluation of postoperative hand function and degree of scarring and objective donor-site function assessment including range of wrist movements and grip strength before and after surgery between the two groups. RESULTS: No skin grafts were used in the VRFF group, and 20 of 21 patients achieved primary healing at donor site, while all patients from the RFF group had skin grafts. And 18 of 23 patients achieved primary healing. The postoperative scar score of donor site in the VRFF group was significantly higher than that in the RFF group (3.4 vs 2.8, P = 0.035). There were no significant differences in other subjective evaluation and donor-site morbidity and hand function assessment. CONCLUSION: VRFF is able to provide a new and simple method to close donor-site defect and realize a better healing in donor site. BioMed Central 2023-04-10 /pmc/articles/PMC10084695/ /pubmed/37032354 http://dx.doi.org/10.1186/s12957-023-02989-9 Text en © The Author(s) 2023 https://creativecommons.org/licenses/by/4.0/ Open AccessThis article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons licence, and indicate if changes were made. The images or other third party material in this article are included in the article's Creative Commons licence, unless indicated otherwise in a credit line to the material. If material is not included in the article's Creative Commons licence and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this licence, visit http://creativecommons.org/licenses/by/4.0/ (https://creativecommons.org/licenses/by/4.0/) . The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/ (https://creativecommons.org/publicdomain/zero/1.0/) ) applies to the data made available in this article, unless otherwise stated in a credit line to the data. |
spellingShingle | Research Zhao, Wenquan Zhu, Wenyuan Yu, Dan Zhu, Huiyong Liu, Jianhua Ni, Youkang Novel V-shaped kiss flap harvest technique for the forearm free flap in soft tissue reconstruction |
title | Novel V-shaped kiss flap harvest technique for the forearm free flap in soft tissue reconstruction |
title_full | Novel V-shaped kiss flap harvest technique for the forearm free flap in soft tissue reconstruction |
title_fullStr | Novel V-shaped kiss flap harvest technique for the forearm free flap in soft tissue reconstruction |
title_full_unstemmed | Novel V-shaped kiss flap harvest technique for the forearm free flap in soft tissue reconstruction |
title_short | Novel V-shaped kiss flap harvest technique for the forearm free flap in soft tissue reconstruction |
title_sort | novel v-shaped kiss flap harvest technique for the forearm free flap in soft tissue reconstruction |
topic | Research |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10084695/ https://www.ncbi.nlm.nih.gov/pubmed/37032354 http://dx.doi.org/10.1186/s12957-023-02989-9 |
work_keys_str_mv | AT zhaowenquan novelvshapedkissflapharvesttechniquefortheforearmfreeflapinsofttissuereconstruction AT zhuwenyuan novelvshapedkissflapharvesttechniquefortheforearmfreeflapinsofttissuereconstruction AT yudan novelvshapedkissflapharvesttechniquefortheforearmfreeflapinsofttissuereconstruction AT zhuhuiyong novelvshapedkissflapharvesttechniquefortheforearmfreeflapinsofttissuereconstruction AT liujianhua novelvshapedkissflapharvesttechniquefortheforearmfreeflapinsofttissuereconstruction AT niyoukang novelvshapedkissflapharvesttechniquefortheforearmfreeflapinsofttissuereconstruction |