Cargando…

Is mental health staff training in de-escalation techniques effective in reducing violent incidents in forensic psychiatric settings? – A systematic review of the literature

BACKGROUND: Inpatient violence is a relevant issue in forensic psychiatric settings. Relevant guidelines recommend that restrictive measures are to be used exclusively if de-escalation and other preventive strategies have failed and there is a risk of harm to patients or staff if no action is taken....

Descripción completa

Detalles Bibliográficos
Autores principales: Brenig, Daniel, Gade, Pauline, Voellm, Birgit
Formato: Online Artículo Texto
Lenguaje:English
Publicado: BioMed Central 2023
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10099889/
https://www.ncbi.nlm.nih.gov/pubmed/37046228
http://dx.doi.org/10.1186/s12888-023-04714-y
_version_ 1785025156086759424
author Brenig, Daniel
Gade, Pauline
Voellm, Birgit
author_facet Brenig, Daniel
Gade, Pauline
Voellm, Birgit
author_sort Brenig, Daniel
collection PubMed
description BACKGROUND: Inpatient violence is a relevant issue in forensic psychiatric settings. Relevant guidelines recommend that restrictive measures are to be used exclusively if de-escalation and other preventive strategies have failed and there is a risk of harm to patients or staff if no action is taken. However, restrictive measures are untherapeutic and can be harmful. In order to enable staff to intervene before inpatient violence or other serious incidents occur and thus to avoid restrictive measures, mental health staff training programs including de-escalation components are being adopted in general as well as forensic mental health settings. There is growing evidence for the efficacy of mental health staff training in de-escalation techniques in the field of general psychiatry. However, there are no reviews evaluating the effectiveness of these interventions in reducing violent incidents in forensic psychiatric settings. Here we present the first literature review on the effectiveness staff training in de-escalation techniques in the field of forensic psychiatry. METHOD: We searched relevant databases for original research on the effectiveness of reducing violence in forensic psychiatric settings. Studies were included if they investigated staff training programs with de-escalation techniques in forensic mental health settings. RESULTS: A total of 5 relevant studies were identified. None of the studies was a randomized controlled trial. Four studies were before and after comparisons without control group. A one group post-test-only design was used in one study. Methodological quality was low. The maximum sample size was 112 participants. Results indicated no relevant impact of mental health staff training in de-escalation techniques on the rate of violent incidents in forensic psychiatric wards. However, staff seemed to feel safer following the training. Results have to be interpreted cautiously due to several methodological and content-related limitations. DISCUSSION: Evidence for the effectiveness of staff training in de-escalation techniques on reducing verbal and physical aggression in forensic settings remains very limited. The existing definitions of terms like de-escalation, de-escalation training and de-escalation techniques in the healthcare context appear rather vague. Although some positive changes are reported across a variety of outcome measures it remains unclear to what extent staff training in de-esclation techniques contributes to a reduction in aggressive incidents and restrictive measures in forensic psychiatry. The clinical implications of this review are therefore limited. Yet, an important implication for future research is that a more comprehensive approach might prove worthwhile. Conducting a further review integrating a wide range of complex interventions aimed at the reduction of inpatient violence rather than focusing on de-escalation only, might be a worthwhile approach. SUPPLEMENTARY INFORMATION: The online version contains supplementary material available at 10.1186/s12888-023-04714-y.
format Online
Article
Text
id pubmed-10099889
institution National Center for Biotechnology Information
language English
publishDate 2023
publisher BioMed Central
record_format MEDLINE/PubMed
spelling pubmed-100998892023-04-14 Is mental health staff training in de-escalation techniques effective in reducing violent incidents in forensic psychiatric settings? – A systematic review of the literature Brenig, Daniel Gade, Pauline Voellm, Birgit BMC Psychiatry Research BACKGROUND: Inpatient violence is a relevant issue in forensic psychiatric settings. Relevant guidelines recommend that restrictive measures are to be used exclusively if de-escalation and other preventive strategies have failed and there is a risk of harm to patients or staff if no action is taken. However, restrictive measures are untherapeutic and can be harmful. In order to enable staff to intervene before inpatient violence or other serious incidents occur and thus to avoid restrictive measures, mental health staff training programs including de-escalation components are being adopted in general as well as forensic mental health settings. There is growing evidence for the efficacy of mental health staff training in de-escalation techniques in the field of general psychiatry. However, there are no reviews evaluating the effectiveness of these interventions in reducing violent incidents in forensic psychiatric settings. Here we present the first literature review on the effectiveness staff training in de-escalation techniques in the field of forensic psychiatry. METHOD: We searched relevant databases for original research on the effectiveness of reducing violence in forensic psychiatric settings. Studies were included if they investigated staff training programs with de-escalation techniques in forensic mental health settings. RESULTS: A total of 5 relevant studies were identified. None of the studies was a randomized controlled trial. Four studies were before and after comparisons without control group. A one group post-test-only design was used in one study. Methodological quality was low. The maximum sample size was 112 participants. Results indicated no relevant impact of mental health staff training in de-escalation techniques on the rate of violent incidents in forensic psychiatric wards. However, staff seemed to feel safer following the training. Results have to be interpreted cautiously due to several methodological and content-related limitations. DISCUSSION: Evidence for the effectiveness of staff training in de-escalation techniques on reducing verbal and physical aggression in forensic settings remains very limited. The existing definitions of terms like de-escalation, de-escalation training and de-escalation techniques in the healthcare context appear rather vague. Although some positive changes are reported across a variety of outcome measures it remains unclear to what extent staff training in de-esclation techniques contributes to a reduction in aggressive incidents and restrictive measures in forensic psychiatry. The clinical implications of this review are therefore limited. Yet, an important implication for future research is that a more comprehensive approach might prove worthwhile. Conducting a further review integrating a wide range of complex interventions aimed at the reduction of inpatient violence rather than focusing on de-escalation only, might be a worthwhile approach. SUPPLEMENTARY INFORMATION: The online version contains supplementary material available at 10.1186/s12888-023-04714-y. BioMed Central 2023-04-12 /pmc/articles/PMC10099889/ /pubmed/37046228 http://dx.doi.org/10.1186/s12888-023-04714-y Text en © The Author(s) 2023 https://creativecommons.org/licenses/by/4.0/Open AccessThis article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons licence, and indicate if changes were made. The images or other third party material in this article are included in the article's Creative Commons licence, unless indicated otherwise in a credit line to the material. If material is not included in the article's Creative Commons licence and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this licence, visit http://creativecommons.org/licenses/by/4.0/ (https://creativecommons.org/licenses/by/4.0/) . The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/ (https://creativecommons.org/publicdomain/zero/1.0/) ) applies to the data made available in this article, unless otherwise stated in a credit line to the data.
spellingShingle Research
Brenig, Daniel
Gade, Pauline
Voellm, Birgit
Is mental health staff training in de-escalation techniques effective in reducing violent incidents in forensic psychiatric settings? – A systematic review of the literature
title Is mental health staff training in de-escalation techniques effective in reducing violent incidents in forensic psychiatric settings? – A systematic review of the literature
title_full Is mental health staff training in de-escalation techniques effective in reducing violent incidents in forensic psychiatric settings? – A systematic review of the literature
title_fullStr Is mental health staff training in de-escalation techniques effective in reducing violent incidents in forensic psychiatric settings? – A systematic review of the literature
title_full_unstemmed Is mental health staff training in de-escalation techniques effective in reducing violent incidents in forensic psychiatric settings? – A systematic review of the literature
title_short Is mental health staff training in de-escalation techniques effective in reducing violent incidents in forensic psychiatric settings? – A systematic review of the literature
title_sort is mental health staff training in de-escalation techniques effective in reducing violent incidents in forensic psychiatric settings? – a systematic review of the literature
topic Research
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10099889/
https://www.ncbi.nlm.nih.gov/pubmed/37046228
http://dx.doi.org/10.1186/s12888-023-04714-y
work_keys_str_mv AT brenigdaniel ismentalhealthstafftrainingindeescalationtechniqueseffectiveinreducingviolentincidentsinforensicpsychiatricsettingsasystematicreviewoftheliterature
AT gadepauline ismentalhealthstafftrainingindeescalationtechniqueseffectiveinreducingviolentincidentsinforensicpsychiatricsettingsasystematicreviewoftheliterature
AT voellmbirgit ismentalhealthstafftrainingindeescalationtechniqueseffectiveinreducingviolentincidentsinforensicpsychiatricsettingsasystematicreviewoftheliterature