Cargando…
Generation of a symmetrical trispecific NK cell engager based on a two-in-one antibody
To construct a trispecific IgG-like antibody at least three different binding moieties need to be combined, which results in a complex architecture and challenging production of these molecules. Here we report for the first time the construction of trispecific natural killer cell engagers based on a...
Autores principales: | , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Frontiers Media S.A.
2023
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10110854/ https://www.ncbi.nlm.nih.gov/pubmed/37081888 http://dx.doi.org/10.3389/fimmu.2023.1170042 |
_version_ | 1785027330988572672 |
---|---|
author | Harwardt, Julia Carrara, Stefania C. Bogen, Jan P. Schoenfeld, Katrin Grzeschik, Julius Hock, Björn Kolmar, Harald |
author_facet | Harwardt, Julia Carrara, Stefania C. Bogen, Jan P. Schoenfeld, Katrin Grzeschik, Julius Hock, Björn Kolmar, Harald |
author_sort | Harwardt, Julia |
collection | PubMed |
description | To construct a trispecific IgG-like antibody at least three different binding moieties need to be combined, which results in a complex architecture and challenging production of these molecules. Here we report for the first time the construction of trispecific natural killer cell engagers based on a previously reported two-in-one antibody combined with a novel anti-CD16a common light chain module identified by yeast surface display (YSD) screening of chicken-derived immune libraries. The resulting antibodies simultaneously target epidermal growth factor receptor (EGFR), programmed death-ligand 1 (PD-L1) and CD16a with two Fab fragments, resulting in specific cellular binding properties on EGFR/PD-L1 double positive tumor cells and a potent ADCC effect. This study paves the way for further development of multispecific therapeutic antibodies derived from avian immunization with desired target combinations, valencies, molecular symmetries and architectures. |
format | Online Article Text |
id | pubmed-10110854 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2023 |
publisher | Frontiers Media S.A. |
record_format | MEDLINE/PubMed |
spelling | pubmed-101108542023-04-19 Generation of a symmetrical trispecific NK cell engager based on a two-in-one antibody Harwardt, Julia Carrara, Stefania C. Bogen, Jan P. Schoenfeld, Katrin Grzeschik, Julius Hock, Björn Kolmar, Harald Front Immunol Immunology To construct a trispecific IgG-like antibody at least three different binding moieties need to be combined, which results in a complex architecture and challenging production of these molecules. Here we report for the first time the construction of trispecific natural killer cell engagers based on a previously reported two-in-one antibody combined with a novel anti-CD16a common light chain module identified by yeast surface display (YSD) screening of chicken-derived immune libraries. The resulting antibodies simultaneously target epidermal growth factor receptor (EGFR), programmed death-ligand 1 (PD-L1) and CD16a with two Fab fragments, resulting in specific cellular binding properties on EGFR/PD-L1 double positive tumor cells and a potent ADCC effect. This study paves the way for further development of multispecific therapeutic antibodies derived from avian immunization with desired target combinations, valencies, molecular symmetries and architectures. Frontiers Media S.A. 2023-04-04 /pmc/articles/PMC10110854/ /pubmed/37081888 http://dx.doi.org/10.3389/fimmu.2023.1170042 Text en Copyright © 2023 Harwardt, Carrara, Bogen, Schoenfeld, Grzeschik, Hock and Kolmar https://creativecommons.org/licenses/by/4.0/This is an open-access article distributed under the terms of the Creative Commons Attribution License (CC BY). The use, distribution or reproduction in other forums is permitted, provided the original author(s) and the copyright owner(s) are credited and that the original publication in this journal is cited, in accordance with accepted academic practice. No use, distribution or reproduction is permitted which does not comply with these terms. |
spellingShingle | Immunology Harwardt, Julia Carrara, Stefania C. Bogen, Jan P. Schoenfeld, Katrin Grzeschik, Julius Hock, Björn Kolmar, Harald Generation of a symmetrical trispecific NK cell engager based on a two-in-one antibody |
title | Generation of a symmetrical trispecific NK cell engager based on a two-in-one antibody |
title_full | Generation of a symmetrical trispecific NK cell engager based on a two-in-one antibody |
title_fullStr | Generation of a symmetrical trispecific NK cell engager based on a two-in-one antibody |
title_full_unstemmed | Generation of a symmetrical trispecific NK cell engager based on a two-in-one antibody |
title_short | Generation of a symmetrical trispecific NK cell engager based on a two-in-one antibody |
title_sort | generation of a symmetrical trispecific nk cell engager based on a two-in-one antibody |
topic | Immunology |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10110854/ https://www.ncbi.nlm.nih.gov/pubmed/37081888 http://dx.doi.org/10.3389/fimmu.2023.1170042 |
work_keys_str_mv | AT harwardtjulia generationofasymmetricaltrispecificnkcellengagerbasedonatwoinoneantibody AT carrarastefaniac generationofasymmetricaltrispecificnkcellengagerbasedonatwoinoneantibody AT bogenjanp generationofasymmetricaltrispecificnkcellengagerbasedonatwoinoneantibody AT schoenfeldkatrin generationofasymmetricaltrispecificnkcellengagerbasedonatwoinoneantibody AT grzeschikjulius generationofasymmetricaltrispecificnkcellengagerbasedonatwoinoneantibody AT hockbjorn generationofasymmetricaltrispecificnkcellengagerbasedonatwoinoneantibody AT kolmarharald generationofasymmetricaltrispecificnkcellengagerbasedonatwoinoneantibody |