Cargando…

Generation of a symmetrical trispecific NK cell engager based on a two-in-one antibody

To construct a trispecific IgG-like antibody at least three different binding moieties need to be combined, which results in a complex architecture and challenging production of these molecules. Here we report for the first time the construction of trispecific natural killer cell engagers based on a...

Descripción completa

Detalles Bibliográficos
Autores principales: Harwardt, Julia, Carrara, Stefania C., Bogen, Jan P., Schoenfeld, Katrin, Grzeschik, Julius, Hock, Björn, Kolmar, Harald
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Frontiers Media S.A. 2023
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10110854/
https://www.ncbi.nlm.nih.gov/pubmed/37081888
http://dx.doi.org/10.3389/fimmu.2023.1170042
_version_ 1785027330988572672
author Harwardt, Julia
Carrara, Stefania C.
Bogen, Jan P.
Schoenfeld, Katrin
Grzeschik, Julius
Hock, Björn
Kolmar, Harald
author_facet Harwardt, Julia
Carrara, Stefania C.
Bogen, Jan P.
Schoenfeld, Katrin
Grzeschik, Julius
Hock, Björn
Kolmar, Harald
author_sort Harwardt, Julia
collection PubMed
description To construct a trispecific IgG-like antibody at least three different binding moieties need to be combined, which results in a complex architecture and challenging production of these molecules. Here we report for the first time the construction of trispecific natural killer cell engagers based on a previously reported two-in-one antibody combined with a novel anti-CD16a common light chain module identified by yeast surface display (YSD) screening of chicken-derived immune libraries. The resulting antibodies simultaneously target epidermal growth factor receptor (EGFR), programmed death-ligand 1 (PD-L1) and CD16a with two Fab fragments, resulting in specific cellular binding properties on EGFR/PD-L1 double positive tumor cells and a potent ADCC effect. This study paves the way for further development of multispecific therapeutic antibodies derived from avian immunization with desired target combinations, valencies, molecular symmetries and architectures.
format Online
Article
Text
id pubmed-10110854
institution National Center for Biotechnology Information
language English
publishDate 2023
publisher Frontiers Media S.A.
record_format MEDLINE/PubMed
spelling pubmed-101108542023-04-19 Generation of a symmetrical trispecific NK cell engager based on a two-in-one antibody Harwardt, Julia Carrara, Stefania C. Bogen, Jan P. Schoenfeld, Katrin Grzeschik, Julius Hock, Björn Kolmar, Harald Front Immunol Immunology To construct a trispecific IgG-like antibody at least three different binding moieties need to be combined, which results in a complex architecture and challenging production of these molecules. Here we report for the first time the construction of trispecific natural killer cell engagers based on a previously reported two-in-one antibody combined with a novel anti-CD16a common light chain module identified by yeast surface display (YSD) screening of chicken-derived immune libraries. The resulting antibodies simultaneously target epidermal growth factor receptor (EGFR), programmed death-ligand 1 (PD-L1) and CD16a with two Fab fragments, resulting in specific cellular binding properties on EGFR/PD-L1 double positive tumor cells and a potent ADCC effect. This study paves the way for further development of multispecific therapeutic antibodies derived from avian immunization with desired target combinations, valencies, molecular symmetries and architectures. Frontiers Media S.A. 2023-04-04 /pmc/articles/PMC10110854/ /pubmed/37081888 http://dx.doi.org/10.3389/fimmu.2023.1170042 Text en Copyright © 2023 Harwardt, Carrara, Bogen, Schoenfeld, Grzeschik, Hock and Kolmar https://creativecommons.org/licenses/by/4.0/This is an open-access article distributed under the terms of the Creative Commons Attribution License (CC BY). The use, distribution or reproduction in other forums is permitted, provided the original author(s) and the copyright owner(s) are credited and that the original publication in this journal is cited, in accordance with accepted academic practice. No use, distribution or reproduction is permitted which does not comply with these terms.
spellingShingle Immunology
Harwardt, Julia
Carrara, Stefania C.
Bogen, Jan P.
Schoenfeld, Katrin
Grzeschik, Julius
Hock, Björn
Kolmar, Harald
Generation of a symmetrical trispecific NK cell engager based on a two-in-one antibody
title Generation of a symmetrical trispecific NK cell engager based on a two-in-one antibody
title_full Generation of a symmetrical trispecific NK cell engager based on a two-in-one antibody
title_fullStr Generation of a symmetrical trispecific NK cell engager based on a two-in-one antibody
title_full_unstemmed Generation of a symmetrical trispecific NK cell engager based on a two-in-one antibody
title_short Generation of a symmetrical trispecific NK cell engager based on a two-in-one antibody
title_sort generation of a symmetrical trispecific nk cell engager based on a two-in-one antibody
topic Immunology
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10110854/
https://www.ncbi.nlm.nih.gov/pubmed/37081888
http://dx.doi.org/10.3389/fimmu.2023.1170042
work_keys_str_mv AT harwardtjulia generationofasymmetricaltrispecificnkcellengagerbasedonatwoinoneantibody
AT carrarastefaniac generationofasymmetricaltrispecificnkcellengagerbasedonatwoinoneantibody
AT bogenjanp generationofasymmetricaltrispecificnkcellengagerbasedonatwoinoneantibody
AT schoenfeldkatrin generationofasymmetricaltrispecificnkcellengagerbasedonatwoinoneantibody
AT grzeschikjulius generationofasymmetricaltrispecificnkcellengagerbasedonatwoinoneantibody
AT hockbjorn generationofasymmetricaltrispecificnkcellengagerbasedonatwoinoneantibody
AT kolmarharald generationofasymmetricaltrispecificnkcellengagerbasedonatwoinoneantibody