Cargando…

Postoperative clinical outcomes for kinematically, restricted kinematically, or mechanically aligned total knee arthroplasty: a systematic review and network meta-analysis of randomized controlled trials

BACKGROUND: Mechanically aligned total knee arthroplasty (MATKA) is a well-established procedure. Kinematically aligned TKA (KATKA) has been proposed to restore and preserve pre-arthritic knee anatomy. However, normal knee anatomy varies widely, and there have been concerns regarding restoring unusu...

Descripción completa

Detalles Bibliográficos
Autores principales: Miura, Takanori, Takahashi, Tsuneari, Watanabe, Jun, Kataoka, Yuki, Ae, Ryusuke, Saito, Hidetomo, Takeshita, Katsushi, Miyakoshi, Naohisa
Formato: Online Artículo Texto
Lenguaje:English
Publicado: BioMed Central 2023
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10124064/
https://www.ncbi.nlm.nih.gov/pubmed/37095485
http://dx.doi.org/10.1186/s12891-023-06448-0
_version_ 1785029775425798144
author Miura, Takanori
Takahashi, Tsuneari
Watanabe, Jun
Kataoka, Yuki
Ae, Ryusuke
Saito, Hidetomo
Takeshita, Katsushi
Miyakoshi, Naohisa
author_facet Miura, Takanori
Takahashi, Tsuneari
Watanabe, Jun
Kataoka, Yuki
Ae, Ryusuke
Saito, Hidetomo
Takeshita, Katsushi
Miyakoshi, Naohisa
author_sort Miura, Takanori
collection PubMed
description BACKGROUND: Mechanically aligned total knee arthroplasty (MATKA) is a well-established procedure. Kinematically aligned TKA (KATKA) has been proposed to restore and preserve pre-arthritic knee anatomy. However, normal knee anatomy varies widely, and there have been concerns regarding restoring unusual anatomy. Accordingly, restricted KATKA (rKATKA) was introduced to reproduce constitutional knee anatomy within a safe range. This network meta-analysis (NMA) aimed to evaluate the clinical and radiological outcomes of the surgeries. METHODS: We performed a database search on August 20, 2022, which included randomized controlled trials (RCTs) comparing any two of the three surgical TKA techniques for knee osteoarthritis. We conducted a random-effects NMA within the frequentist framework and evaluated confidence in each outcome using the Confidence in Network Meta-Analysis tool. RESULTS: Ten RCTs with 1,008 knees and a median follow-up period of 1.5 years were included. The three methods might result in little to no difference in range of motion (ROM) between methods. In patient-reported outcome measures (PROMs), the KATKA might result in a slight improvement compared with the MATKA (standardized mean difference, 0.47; 95% confidence interval [CI], 0.16–0.78; very low confidence). There was little to no difference in revision risk between MATKA and KATKA. KATKA and rKATKA showed a slight valgus femoral component (mean difference [MD], -1.35; 95% CI, -1.95–[-0.75]; very low confidence; and MD, -1.72; 95% CI, -2.63–[-0.81]; very low confidence, respectively) and a slight varus tibial component (MD, 2.23; 95% CI, 1.22–3.24; very low confidence; and MD, 1.25; 95% CI, 0.01–2.49; very low confidence, respectively) compared with MATKA. Tibial component inclination and hip–knee–ankle angle might result in little to no difference between the three procedures. CONCLUSIONS: KATKA and rKATKA showed similar ROM and PROMs and a slight variation in the coronal component alignment compared with MATKA. KATKA and rKATKA are acceptable methods in short- to mid-term follow-up periods. However, long-term clinical results in patients with severe varus deformity are still lacking. Surgeons should choose surgical procedures carefully. Further trials are warranted to evaluate the efficacy, safety, and subsequent revision risk. SUPPLEMENTARY INFORMATION: The online version contains supplementary material available at 10.1186/s12891-023-06448-0.
format Online
Article
Text
id pubmed-10124064
institution National Center for Biotechnology Information
language English
publishDate 2023
publisher BioMed Central
record_format MEDLINE/PubMed
spelling pubmed-101240642023-04-25 Postoperative clinical outcomes for kinematically, restricted kinematically, or mechanically aligned total knee arthroplasty: a systematic review and network meta-analysis of randomized controlled trials Miura, Takanori Takahashi, Tsuneari Watanabe, Jun Kataoka, Yuki Ae, Ryusuke Saito, Hidetomo Takeshita, Katsushi Miyakoshi, Naohisa BMC Musculoskelet Disord Research BACKGROUND: Mechanically aligned total knee arthroplasty (MATKA) is a well-established procedure. Kinematically aligned TKA (KATKA) has been proposed to restore and preserve pre-arthritic knee anatomy. However, normal knee anatomy varies widely, and there have been concerns regarding restoring unusual anatomy. Accordingly, restricted KATKA (rKATKA) was introduced to reproduce constitutional knee anatomy within a safe range. This network meta-analysis (NMA) aimed to evaluate the clinical and radiological outcomes of the surgeries. METHODS: We performed a database search on August 20, 2022, which included randomized controlled trials (RCTs) comparing any two of the three surgical TKA techniques for knee osteoarthritis. We conducted a random-effects NMA within the frequentist framework and evaluated confidence in each outcome using the Confidence in Network Meta-Analysis tool. RESULTS: Ten RCTs with 1,008 knees and a median follow-up period of 1.5 years were included. The three methods might result in little to no difference in range of motion (ROM) between methods. In patient-reported outcome measures (PROMs), the KATKA might result in a slight improvement compared with the MATKA (standardized mean difference, 0.47; 95% confidence interval [CI], 0.16–0.78; very low confidence). There was little to no difference in revision risk between MATKA and KATKA. KATKA and rKATKA showed a slight valgus femoral component (mean difference [MD], -1.35; 95% CI, -1.95–[-0.75]; very low confidence; and MD, -1.72; 95% CI, -2.63–[-0.81]; very low confidence, respectively) and a slight varus tibial component (MD, 2.23; 95% CI, 1.22–3.24; very low confidence; and MD, 1.25; 95% CI, 0.01–2.49; very low confidence, respectively) compared with MATKA. Tibial component inclination and hip–knee–ankle angle might result in little to no difference between the three procedures. CONCLUSIONS: KATKA and rKATKA showed similar ROM and PROMs and a slight variation in the coronal component alignment compared with MATKA. KATKA and rKATKA are acceptable methods in short- to mid-term follow-up periods. However, long-term clinical results in patients with severe varus deformity are still lacking. Surgeons should choose surgical procedures carefully. Further trials are warranted to evaluate the efficacy, safety, and subsequent revision risk. SUPPLEMENTARY INFORMATION: The online version contains supplementary material available at 10.1186/s12891-023-06448-0. BioMed Central 2023-04-24 /pmc/articles/PMC10124064/ /pubmed/37095485 http://dx.doi.org/10.1186/s12891-023-06448-0 Text en © The Author(s) 2023 https://creativecommons.org/licenses/by/4.0/Open AccessThis article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons licence, and indicate if changes were made. The images or other third party material in this article are included in the article's Creative Commons licence, unless indicated otherwise in a credit line to the material. If material is not included in the article's Creative Commons licence and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this licence, visit http://creativecommons.org/licenses/by/4.0/ (https://creativecommons.org/licenses/by/4.0/) . The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/ (https://creativecommons.org/publicdomain/zero/1.0/) ) applies to the data made available in this article, unless otherwise stated in a credit line to the data.
spellingShingle Research
Miura, Takanori
Takahashi, Tsuneari
Watanabe, Jun
Kataoka, Yuki
Ae, Ryusuke
Saito, Hidetomo
Takeshita, Katsushi
Miyakoshi, Naohisa
Postoperative clinical outcomes for kinematically, restricted kinematically, or mechanically aligned total knee arthroplasty: a systematic review and network meta-analysis of randomized controlled trials
title Postoperative clinical outcomes for kinematically, restricted kinematically, or mechanically aligned total knee arthroplasty: a systematic review and network meta-analysis of randomized controlled trials
title_full Postoperative clinical outcomes for kinematically, restricted kinematically, or mechanically aligned total knee arthroplasty: a systematic review and network meta-analysis of randomized controlled trials
title_fullStr Postoperative clinical outcomes for kinematically, restricted kinematically, or mechanically aligned total knee arthroplasty: a systematic review and network meta-analysis of randomized controlled trials
title_full_unstemmed Postoperative clinical outcomes for kinematically, restricted kinematically, or mechanically aligned total knee arthroplasty: a systematic review and network meta-analysis of randomized controlled trials
title_short Postoperative clinical outcomes for kinematically, restricted kinematically, or mechanically aligned total knee arthroplasty: a systematic review and network meta-analysis of randomized controlled trials
title_sort postoperative clinical outcomes for kinematically, restricted kinematically, or mechanically aligned total knee arthroplasty: a systematic review and network meta-analysis of randomized controlled trials
topic Research
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10124064/
https://www.ncbi.nlm.nih.gov/pubmed/37095485
http://dx.doi.org/10.1186/s12891-023-06448-0
work_keys_str_mv AT miuratakanori postoperativeclinicaloutcomesforkinematicallyrestrictedkinematicallyormechanicallyalignedtotalkneearthroplastyasystematicreviewandnetworkmetaanalysisofrandomizedcontrolledtrials
AT takahashitsuneari postoperativeclinicaloutcomesforkinematicallyrestrictedkinematicallyormechanicallyalignedtotalkneearthroplastyasystematicreviewandnetworkmetaanalysisofrandomizedcontrolledtrials
AT watanabejun postoperativeclinicaloutcomesforkinematicallyrestrictedkinematicallyormechanicallyalignedtotalkneearthroplastyasystematicreviewandnetworkmetaanalysisofrandomizedcontrolledtrials
AT kataokayuki postoperativeclinicaloutcomesforkinematicallyrestrictedkinematicallyormechanicallyalignedtotalkneearthroplastyasystematicreviewandnetworkmetaanalysisofrandomizedcontrolledtrials
AT aeryusuke postoperativeclinicaloutcomesforkinematicallyrestrictedkinematicallyormechanicallyalignedtotalkneearthroplastyasystematicreviewandnetworkmetaanalysisofrandomizedcontrolledtrials
AT saitohidetomo postoperativeclinicaloutcomesforkinematicallyrestrictedkinematicallyormechanicallyalignedtotalkneearthroplastyasystematicreviewandnetworkmetaanalysisofrandomizedcontrolledtrials
AT takeshitakatsushi postoperativeclinicaloutcomesforkinematicallyrestrictedkinematicallyormechanicallyalignedtotalkneearthroplastyasystematicreviewandnetworkmetaanalysisofrandomizedcontrolledtrials
AT miyakoshinaohisa postoperativeclinicaloutcomesforkinematicallyrestrictedkinematicallyormechanicallyalignedtotalkneearthroplastyasystematicreviewandnetworkmetaanalysisofrandomizedcontrolledtrials