Cargando…

SLC38A10 Deficiency in Mice Affects Plasma Levels of Threonine and Histidine in Males but Not in Females: A Preliminary Characterization Study of SLC38A10(−/−) Mice

Solute carriers belong to the biggest group of transporters in the human genome, but more knowledge is needed to fully understand their function and possible role as therapeutic targets. SLC38A10, a poorly characterized solute carrier, is preliminary characterized here. By using a knockout mouse mod...

Descripción completa

Detalles Bibliográficos
Autores principales: Lindberg, Frida A., Nordenankar, Karin, Forsberg, Erica C., Fredriksson, Robert
Formato: Online Artículo Texto
Lenguaje:English
Publicado: MDPI 2023
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10138244/
https://www.ncbi.nlm.nih.gov/pubmed/37107593
http://dx.doi.org/10.3390/genes14040835
_version_ 1785032661134213120
author Lindberg, Frida A.
Nordenankar, Karin
Forsberg, Erica C.
Fredriksson, Robert
author_facet Lindberg, Frida A.
Nordenankar, Karin
Forsberg, Erica C.
Fredriksson, Robert
author_sort Lindberg, Frida A.
collection PubMed
description Solute carriers belong to the biggest group of transporters in the human genome, but more knowledge is needed to fully understand their function and possible role as therapeutic targets. SLC38A10, a poorly characterized solute carrier, is preliminary characterized here. By using a knockout mouse model, we studied the biological effects of SLC38A10 deficiency in vivo. We performed a transcriptomic analysis of the whole brain and found seven differentially expressed genes in SLC38A10-deficient mice (Gm48159, Nr4a1, Tuba1c, Lrrc56, mt-Tp, Hbb-bt and Snord116/9). By measuring amino acids in plasma, we found lower levels of threonine and histidine in knockout males, whereas no amino acid levels were affected in females, suggesting that SLC38A10(−/−) might affect sexes differently. Using RT-qPCR, we investigated the effect of SLC38A10 deficiency on mRNA expression of other SLC38 members, Mtor and Rps6kb1 in the brain, liver, lung, muscle, and kidney, but no differences were found. Relative telomere length measurement was also taken, as a marker for cellular age, but no differences were found between the genotypes. We conclude that SLC38A10 might be important for keeping amino acid homeostasis in plasma, at least in males, but no major effects were seen on transcriptomic expression or telomere length in the whole brain.
format Online
Article
Text
id pubmed-10138244
institution National Center for Biotechnology Information
language English
publishDate 2023
publisher MDPI
record_format MEDLINE/PubMed
spelling pubmed-101382442023-04-28 SLC38A10 Deficiency in Mice Affects Plasma Levels of Threonine and Histidine in Males but Not in Females: A Preliminary Characterization Study of SLC38A10(−/−) Mice Lindberg, Frida A. Nordenankar, Karin Forsberg, Erica C. Fredriksson, Robert Genes (Basel) Article Solute carriers belong to the biggest group of transporters in the human genome, but more knowledge is needed to fully understand their function and possible role as therapeutic targets. SLC38A10, a poorly characterized solute carrier, is preliminary characterized here. By using a knockout mouse model, we studied the biological effects of SLC38A10 deficiency in vivo. We performed a transcriptomic analysis of the whole brain and found seven differentially expressed genes in SLC38A10-deficient mice (Gm48159, Nr4a1, Tuba1c, Lrrc56, mt-Tp, Hbb-bt and Snord116/9). By measuring amino acids in plasma, we found lower levels of threonine and histidine in knockout males, whereas no amino acid levels were affected in females, suggesting that SLC38A10(−/−) might affect sexes differently. Using RT-qPCR, we investigated the effect of SLC38A10 deficiency on mRNA expression of other SLC38 members, Mtor and Rps6kb1 in the brain, liver, lung, muscle, and kidney, but no differences were found. Relative telomere length measurement was also taken, as a marker for cellular age, but no differences were found between the genotypes. We conclude that SLC38A10 might be important for keeping amino acid homeostasis in plasma, at least in males, but no major effects were seen on transcriptomic expression or telomere length in the whole brain. MDPI 2023-03-30 /pmc/articles/PMC10138244/ /pubmed/37107593 http://dx.doi.org/10.3390/genes14040835 Text en © 2023 by the authors. https://creativecommons.org/licenses/by/4.0/Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (https://creativecommons.org/licenses/by/4.0/).
spellingShingle Article
Lindberg, Frida A.
Nordenankar, Karin
Forsberg, Erica C.
Fredriksson, Robert
SLC38A10 Deficiency in Mice Affects Plasma Levels of Threonine and Histidine in Males but Not in Females: A Preliminary Characterization Study of SLC38A10(−/−) Mice
title SLC38A10 Deficiency in Mice Affects Plasma Levels of Threonine and Histidine in Males but Not in Females: A Preliminary Characterization Study of SLC38A10(−/−) Mice
title_full SLC38A10 Deficiency in Mice Affects Plasma Levels of Threonine and Histidine in Males but Not in Females: A Preliminary Characterization Study of SLC38A10(−/−) Mice
title_fullStr SLC38A10 Deficiency in Mice Affects Plasma Levels of Threonine and Histidine in Males but Not in Females: A Preliminary Characterization Study of SLC38A10(−/−) Mice
title_full_unstemmed SLC38A10 Deficiency in Mice Affects Plasma Levels of Threonine and Histidine in Males but Not in Females: A Preliminary Characterization Study of SLC38A10(−/−) Mice
title_short SLC38A10 Deficiency in Mice Affects Plasma Levels of Threonine and Histidine in Males but Not in Females: A Preliminary Characterization Study of SLC38A10(−/−) Mice
title_sort slc38a10 deficiency in mice affects plasma levels of threonine and histidine in males but not in females: a preliminary characterization study of slc38a10(−/−) mice
topic Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10138244/
https://www.ncbi.nlm.nih.gov/pubmed/37107593
http://dx.doi.org/10.3390/genes14040835
work_keys_str_mv AT lindbergfridaa slc38a10deficiencyinmiceaffectsplasmalevelsofthreonineandhistidineinmalesbutnotinfemalesapreliminarycharacterizationstudyofslc38a10mice
AT nordenankarkarin slc38a10deficiencyinmiceaffectsplasmalevelsofthreonineandhistidineinmalesbutnotinfemalesapreliminarycharacterizationstudyofslc38a10mice
AT forsbergericac slc38a10deficiencyinmiceaffectsplasmalevelsofthreonineandhistidineinmalesbutnotinfemalesapreliminarycharacterizationstudyofslc38a10mice
AT fredrikssonrobert slc38a10deficiencyinmiceaffectsplasmalevelsofthreonineandhistidineinmalesbutnotinfemalesapreliminarycharacterizationstudyofslc38a10mice