Cargando…
SLC38A10 Deficiency in Mice Affects Plasma Levels of Threonine and Histidine in Males but Not in Females: A Preliminary Characterization Study of SLC38A10(−/−) Mice
Solute carriers belong to the biggest group of transporters in the human genome, but more knowledge is needed to fully understand their function and possible role as therapeutic targets. SLC38A10, a poorly characterized solute carrier, is preliminary characterized here. By using a knockout mouse mod...
Autores principales: | , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
MDPI
2023
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10138244/ https://www.ncbi.nlm.nih.gov/pubmed/37107593 http://dx.doi.org/10.3390/genes14040835 |
_version_ | 1785032661134213120 |
---|---|
author | Lindberg, Frida A. Nordenankar, Karin Forsberg, Erica C. Fredriksson, Robert |
author_facet | Lindberg, Frida A. Nordenankar, Karin Forsberg, Erica C. Fredriksson, Robert |
author_sort | Lindberg, Frida A. |
collection | PubMed |
description | Solute carriers belong to the biggest group of transporters in the human genome, but more knowledge is needed to fully understand their function and possible role as therapeutic targets. SLC38A10, a poorly characterized solute carrier, is preliminary characterized here. By using a knockout mouse model, we studied the biological effects of SLC38A10 deficiency in vivo. We performed a transcriptomic analysis of the whole brain and found seven differentially expressed genes in SLC38A10-deficient mice (Gm48159, Nr4a1, Tuba1c, Lrrc56, mt-Tp, Hbb-bt and Snord116/9). By measuring amino acids in plasma, we found lower levels of threonine and histidine in knockout males, whereas no amino acid levels were affected in females, suggesting that SLC38A10(−/−) might affect sexes differently. Using RT-qPCR, we investigated the effect of SLC38A10 deficiency on mRNA expression of other SLC38 members, Mtor and Rps6kb1 in the brain, liver, lung, muscle, and kidney, but no differences were found. Relative telomere length measurement was also taken, as a marker for cellular age, but no differences were found between the genotypes. We conclude that SLC38A10 might be important for keeping amino acid homeostasis in plasma, at least in males, but no major effects were seen on transcriptomic expression or telomere length in the whole brain. |
format | Online Article Text |
id | pubmed-10138244 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2023 |
publisher | MDPI |
record_format | MEDLINE/PubMed |
spelling | pubmed-101382442023-04-28 SLC38A10 Deficiency in Mice Affects Plasma Levels of Threonine and Histidine in Males but Not in Females: A Preliminary Characterization Study of SLC38A10(−/−) Mice Lindberg, Frida A. Nordenankar, Karin Forsberg, Erica C. Fredriksson, Robert Genes (Basel) Article Solute carriers belong to the biggest group of transporters in the human genome, but more knowledge is needed to fully understand their function and possible role as therapeutic targets. SLC38A10, a poorly characterized solute carrier, is preliminary characterized here. By using a knockout mouse model, we studied the biological effects of SLC38A10 deficiency in vivo. We performed a transcriptomic analysis of the whole brain and found seven differentially expressed genes in SLC38A10-deficient mice (Gm48159, Nr4a1, Tuba1c, Lrrc56, mt-Tp, Hbb-bt and Snord116/9). By measuring amino acids in plasma, we found lower levels of threonine and histidine in knockout males, whereas no amino acid levels were affected in females, suggesting that SLC38A10(−/−) might affect sexes differently. Using RT-qPCR, we investigated the effect of SLC38A10 deficiency on mRNA expression of other SLC38 members, Mtor and Rps6kb1 in the brain, liver, lung, muscle, and kidney, but no differences were found. Relative telomere length measurement was also taken, as a marker for cellular age, but no differences were found between the genotypes. We conclude that SLC38A10 might be important for keeping amino acid homeostasis in plasma, at least in males, but no major effects were seen on transcriptomic expression or telomere length in the whole brain. MDPI 2023-03-30 /pmc/articles/PMC10138244/ /pubmed/37107593 http://dx.doi.org/10.3390/genes14040835 Text en © 2023 by the authors. https://creativecommons.org/licenses/by/4.0/Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (https://creativecommons.org/licenses/by/4.0/). |
spellingShingle | Article Lindberg, Frida A. Nordenankar, Karin Forsberg, Erica C. Fredriksson, Robert SLC38A10 Deficiency in Mice Affects Plasma Levels of Threonine and Histidine in Males but Not in Females: A Preliminary Characterization Study of SLC38A10(−/−) Mice |
title | SLC38A10 Deficiency in Mice Affects Plasma Levels of Threonine and Histidine in Males but Not in Females: A Preliminary Characterization Study of SLC38A10(−/−) Mice |
title_full | SLC38A10 Deficiency in Mice Affects Plasma Levels of Threonine and Histidine in Males but Not in Females: A Preliminary Characterization Study of SLC38A10(−/−) Mice |
title_fullStr | SLC38A10 Deficiency in Mice Affects Plasma Levels of Threonine and Histidine in Males but Not in Females: A Preliminary Characterization Study of SLC38A10(−/−) Mice |
title_full_unstemmed | SLC38A10 Deficiency in Mice Affects Plasma Levels of Threonine and Histidine in Males but Not in Females: A Preliminary Characterization Study of SLC38A10(−/−) Mice |
title_short | SLC38A10 Deficiency in Mice Affects Plasma Levels of Threonine and Histidine in Males but Not in Females: A Preliminary Characterization Study of SLC38A10(−/−) Mice |
title_sort | slc38a10 deficiency in mice affects plasma levels of threonine and histidine in males but not in females: a preliminary characterization study of slc38a10(−/−) mice |
topic | Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10138244/ https://www.ncbi.nlm.nih.gov/pubmed/37107593 http://dx.doi.org/10.3390/genes14040835 |
work_keys_str_mv | AT lindbergfridaa slc38a10deficiencyinmiceaffectsplasmalevelsofthreonineandhistidineinmalesbutnotinfemalesapreliminarycharacterizationstudyofslc38a10mice AT nordenankarkarin slc38a10deficiencyinmiceaffectsplasmalevelsofthreonineandhistidineinmalesbutnotinfemalesapreliminarycharacterizationstudyofslc38a10mice AT forsbergericac slc38a10deficiencyinmiceaffectsplasmalevelsofthreonineandhistidineinmalesbutnotinfemalesapreliminarycharacterizationstudyofslc38a10mice AT fredrikssonrobert slc38a10deficiencyinmiceaffectsplasmalevelsofthreonineandhistidineinmalesbutnotinfemalesapreliminarycharacterizationstudyofslc38a10mice |