Cargando…
Efficient Cross-Screening and Characterization of Monoclonal Antibodies against Marek’s Disease Specific Meq Oncoprotein Using CRISPR/Cas9-Gene-Edited Viruses
Marek’s disease (MD) caused by pathogenic Marek’s disease virus type 1 (MDV−1) is one of the most important neoplastic diseases of poultry. MDV−1-encoded unique Meq protein is the major oncoprotein and the availability of Meq-specific monoclonal antibodies (mAbs) is crucial for revealing MDV pathoge...
Autores principales: | , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
MDPI
2023
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10142107/ https://www.ncbi.nlm.nih.gov/pubmed/37112797 http://dx.doi.org/10.3390/v15040817 |
_version_ | 1785033535142232064 |
---|---|
author | Teng, Man Liu, Jin-Ling Luo, Qin Zheng, Lu-Ping Yao, Yongxiu Nair, Venugopal Zhang, Gai-Ping Luo, Jun |
author_facet | Teng, Man Liu, Jin-Ling Luo, Qin Zheng, Lu-Ping Yao, Yongxiu Nair, Venugopal Zhang, Gai-Ping Luo, Jun |
author_sort | Teng, Man |
collection | PubMed |
description | Marek’s disease (MD) caused by pathogenic Marek’s disease virus type 1 (MDV−1) is one of the most important neoplastic diseases of poultry. MDV−1-encoded unique Meq protein is the major oncoprotein and the availability of Meq-specific monoclonal antibodies (mAbs) is crucial for revealing MDV pathogenesis/oncogenesis. Using synthesized polypeptides from conserved hydrophilic regions of the Meq protein as immunogens, together with hybridoma technology and primary screening by cross immunofluorescence assay (IFA) on Meq-deleted MDV−1 viruses generated by CRISPR/Cas9-gene editing, a total of five positive hybridomas were generated. Four of these hybridomas, namely 2A9, 5A7, 7F9 and 8G11, were further confirmed to secrete specific antibodies against Meq as confirmed by the IFA staining of 293T cells overexpressing Meq. Confocal microscopic analysis of cells stained with these antibodies confirmed the nuclear localization of Meq in MDV-infected CEF cells and MDV-transformed MSB-1 cells. Furthermore, two mAb hybridoma clones, 2A9-B12 and 8G11-B2 derived from 2A9 and 8G11, respectively, displayed high specificity for Meq proteins of MDV−1 strains with diverse virulence. Our data presented here, using synthesized polypeptide immunization combined with cross IFA staining on CRISPR/Cas9 gene-edited viruses, has provided a new efficient approach for future generation of specific mAbs against viral proteins. |
format | Online Article Text |
id | pubmed-10142107 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2023 |
publisher | MDPI |
record_format | MEDLINE/PubMed |
spelling | pubmed-101421072023-04-29 Efficient Cross-Screening and Characterization of Monoclonal Antibodies against Marek’s Disease Specific Meq Oncoprotein Using CRISPR/Cas9-Gene-Edited Viruses Teng, Man Liu, Jin-Ling Luo, Qin Zheng, Lu-Ping Yao, Yongxiu Nair, Venugopal Zhang, Gai-Ping Luo, Jun Viruses Article Marek’s disease (MD) caused by pathogenic Marek’s disease virus type 1 (MDV−1) is one of the most important neoplastic diseases of poultry. MDV−1-encoded unique Meq protein is the major oncoprotein and the availability of Meq-specific monoclonal antibodies (mAbs) is crucial for revealing MDV pathogenesis/oncogenesis. Using synthesized polypeptides from conserved hydrophilic regions of the Meq protein as immunogens, together with hybridoma technology and primary screening by cross immunofluorescence assay (IFA) on Meq-deleted MDV−1 viruses generated by CRISPR/Cas9-gene editing, a total of five positive hybridomas were generated. Four of these hybridomas, namely 2A9, 5A7, 7F9 and 8G11, were further confirmed to secrete specific antibodies against Meq as confirmed by the IFA staining of 293T cells overexpressing Meq. Confocal microscopic analysis of cells stained with these antibodies confirmed the nuclear localization of Meq in MDV-infected CEF cells and MDV-transformed MSB-1 cells. Furthermore, two mAb hybridoma clones, 2A9-B12 and 8G11-B2 derived from 2A9 and 8G11, respectively, displayed high specificity for Meq proteins of MDV−1 strains with diverse virulence. Our data presented here, using synthesized polypeptide immunization combined with cross IFA staining on CRISPR/Cas9 gene-edited viruses, has provided a new efficient approach for future generation of specific mAbs against viral proteins. MDPI 2023-03-23 /pmc/articles/PMC10142107/ /pubmed/37112797 http://dx.doi.org/10.3390/v15040817 Text en © 2023 by the authors. https://creativecommons.org/licenses/by/4.0/Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (https://creativecommons.org/licenses/by/4.0/). |
spellingShingle | Article Teng, Man Liu, Jin-Ling Luo, Qin Zheng, Lu-Ping Yao, Yongxiu Nair, Venugopal Zhang, Gai-Ping Luo, Jun Efficient Cross-Screening and Characterization of Monoclonal Antibodies against Marek’s Disease Specific Meq Oncoprotein Using CRISPR/Cas9-Gene-Edited Viruses |
title | Efficient Cross-Screening and Characterization of Monoclonal Antibodies against Marek’s Disease Specific Meq Oncoprotein Using CRISPR/Cas9-Gene-Edited Viruses |
title_full | Efficient Cross-Screening and Characterization of Monoclonal Antibodies against Marek’s Disease Specific Meq Oncoprotein Using CRISPR/Cas9-Gene-Edited Viruses |
title_fullStr | Efficient Cross-Screening and Characterization of Monoclonal Antibodies against Marek’s Disease Specific Meq Oncoprotein Using CRISPR/Cas9-Gene-Edited Viruses |
title_full_unstemmed | Efficient Cross-Screening and Characterization of Monoclonal Antibodies against Marek’s Disease Specific Meq Oncoprotein Using CRISPR/Cas9-Gene-Edited Viruses |
title_short | Efficient Cross-Screening and Characterization of Monoclonal Antibodies against Marek’s Disease Specific Meq Oncoprotein Using CRISPR/Cas9-Gene-Edited Viruses |
title_sort | efficient cross-screening and characterization of monoclonal antibodies against marek’s disease specific meq oncoprotein using crispr/cas9-gene-edited viruses |
topic | Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10142107/ https://www.ncbi.nlm.nih.gov/pubmed/37112797 http://dx.doi.org/10.3390/v15040817 |
work_keys_str_mv | AT tengman efficientcrossscreeningandcharacterizationofmonoclonalantibodiesagainstmareksdiseasespecificmeqoncoproteinusingcrisprcas9geneeditedviruses AT liujinling efficientcrossscreeningandcharacterizationofmonoclonalantibodiesagainstmareksdiseasespecificmeqoncoproteinusingcrisprcas9geneeditedviruses AT luoqin efficientcrossscreeningandcharacterizationofmonoclonalantibodiesagainstmareksdiseasespecificmeqoncoproteinusingcrisprcas9geneeditedviruses AT zhengluping efficientcrossscreeningandcharacterizationofmonoclonalantibodiesagainstmareksdiseasespecificmeqoncoproteinusingcrisprcas9geneeditedviruses AT yaoyongxiu efficientcrossscreeningandcharacterizationofmonoclonalantibodiesagainstmareksdiseasespecificmeqoncoproteinusingcrisprcas9geneeditedviruses AT nairvenugopal efficientcrossscreeningandcharacterizationofmonoclonalantibodiesagainstmareksdiseasespecificmeqoncoproteinusingcrisprcas9geneeditedviruses AT zhanggaiping efficientcrossscreeningandcharacterizationofmonoclonalantibodiesagainstmareksdiseasespecificmeqoncoproteinusingcrisprcas9geneeditedviruses AT luojun efficientcrossscreeningandcharacterizationofmonoclonalantibodiesagainstmareksdiseasespecificmeqoncoproteinusingcrisprcas9geneeditedviruses |