Cargando…

Efficient Cross-Screening and Characterization of Monoclonal Antibodies against Marek’s Disease Specific Meq Oncoprotein Using CRISPR/Cas9-Gene-Edited Viruses

Marek’s disease (MD) caused by pathogenic Marek’s disease virus type 1 (MDV−1) is one of the most important neoplastic diseases of poultry. MDV−1-encoded unique Meq protein is the major oncoprotein and the availability of Meq-specific monoclonal antibodies (mAbs) is crucial for revealing MDV pathoge...

Descripción completa

Detalles Bibliográficos
Autores principales: Teng, Man, Liu, Jin-Ling, Luo, Qin, Zheng, Lu-Ping, Yao, Yongxiu, Nair, Venugopal, Zhang, Gai-Ping, Luo, Jun
Formato: Online Artículo Texto
Lenguaje:English
Publicado: MDPI 2023
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10142107/
https://www.ncbi.nlm.nih.gov/pubmed/37112797
http://dx.doi.org/10.3390/v15040817
_version_ 1785033535142232064
author Teng, Man
Liu, Jin-Ling
Luo, Qin
Zheng, Lu-Ping
Yao, Yongxiu
Nair, Venugopal
Zhang, Gai-Ping
Luo, Jun
author_facet Teng, Man
Liu, Jin-Ling
Luo, Qin
Zheng, Lu-Ping
Yao, Yongxiu
Nair, Venugopal
Zhang, Gai-Ping
Luo, Jun
author_sort Teng, Man
collection PubMed
description Marek’s disease (MD) caused by pathogenic Marek’s disease virus type 1 (MDV−1) is one of the most important neoplastic diseases of poultry. MDV−1-encoded unique Meq protein is the major oncoprotein and the availability of Meq-specific monoclonal antibodies (mAbs) is crucial for revealing MDV pathogenesis/oncogenesis. Using synthesized polypeptides from conserved hydrophilic regions of the Meq protein as immunogens, together with hybridoma technology and primary screening by cross immunofluorescence assay (IFA) on Meq-deleted MDV−1 viruses generated by CRISPR/Cas9-gene editing, a total of five positive hybridomas were generated. Four of these hybridomas, namely 2A9, 5A7, 7F9 and 8G11, were further confirmed to secrete specific antibodies against Meq as confirmed by the IFA staining of 293T cells overexpressing Meq. Confocal microscopic analysis of cells stained with these antibodies confirmed the nuclear localization of Meq in MDV-infected CEF cells and MDV-transformed MSB-1 cells. Furthermore, two mAb hybridoma clones, 2A9-B12 and 8G11-B2 derived from 2A9 and 8G11, respectively, displayed high specificity for Meq proteins of MDV−1 strains with diverse virulence. Our data presented here, using synthesized polypeptide immunization combined with cross IFA staining on CRISPR/Cas9 gene-edited viruses, has provided a new efficient approach for future generation of specific mAbs against viral proteins.
format Online
Article
Text
id pubmed-10142107
institution National Center for Biotechnology Information
language English
publishDate 2023
publisher MDPI
record_format MEDLINE/PubMed
spelling pubmed-101421072023-04-29 Efficient Cross-Screening and Characterization of Monoclonal Antibodies against Marek’s Disease Specific Meq Oncoprotein Using CRISPR/Cas9-Gene-Edited Viruses Teng, Man Liu, Jin-Ling Luo, Qin Zheng, Lu-Ping Yao, Yongxiu Nair, Venugopal Zhang, Gai-Ping Luo, Jun Viruses Article Marek’s disease (MD) caused by pathogenic Marek’s disease virus type 1 (MDV−1) is one of the most important neoplastic diseases of poultry. MDV−1-encoded unique Meq protein is the major oncoprotein and the availability of Meq-specific monoclonal antibodies (mAbs) is crucial for revealing MDV pathogenesis/oncogenesis. Using synthesized polypeptides from conserved hydrophilic regions of the Meq protein as immunogens, together with hybridoma technology and primary screening by cross immunofluorescence assay (IFA) on Meq-deleted MDV−1 viruses generated by CRISPR/Cas9-gene editing, a total of five positive hybridomas were generated. Four of these hybridomas, namely 2A9, 5A7, 7F9 and 8G11, were further confirmed to secrete specific antibodies against Meq as confirmed by the IFA staining of 293T cells overexpressing Meq. Confocal microscopic analysis of cells stained with these antibodies confirmed the nuclear localization of Meq in MDV-infected CEF cells and MDV-transformed MSB-1 cells. Furthermore, two mAb hybridoma clones, 2A9-B12 and 8G11-B2 derived from 2A9 and 8G11, respectively, displayed high specificity for Meq proteins of MDV−1 strains with diverse virulence. Our data presented here, using synthesized polypeptide immunization combined with cross IFA staining on CRISPR/Cas9 gene-edited viruses, has provided a new efficient approach for future generation of specific mAbs against viral proteins. MDPI 2023-03-23 /pmc/articles/PMC10142107/ /pubmed/37112797 http://dx.doi.org/10.3390/v15040817 Text en © 2023 by the authors. https://creativecommons.org/licenses/by/4.0/Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (https://creativecommons.org/licenses/by/4.0/).
spellingShingle Article
Teng, Man
Liu, Jin-Ling
Luo, Qin
Zheng, Lu-Ping
Yao, Yongxiu
Nair, Venugopal
Zhang, Gai-Ping
Luo, Jun
Efficient Cross-Screening and Characterization of Monoclonal Antibodies against Marek’s Disease Specific Meq Oncoprotein Using CRISPR/Cas9-Gene-Edited Viruses
title Efficient Cross-Screening and Characterization of Monoclonal Antibodies against Marek’s Disease Specific Meq Oncoprotein Using CRISPR/Cas9-Gene-Edited Viruses
title_full Efficient Cross-Screening and Characterization of Monoclonal Antibodies against Marek’s Disease Specific Meq Oncoprotein Using CRISPR/Cas9-Gene-Edited Viruses
title_fullStr Efficient Cross-Screening and Characterization of Monoclonal Antibodies against Marek’s Disease Specific Meq Oncoprotein Using CRISPR/Cas9-Gene-Edited Viruses
title_full_unstemmed Efficient Cross-Screening and Characterization of Monoclonal Antibodies against Marek’s Disease Specific Meq Oncoprotein Using CRISPR/Cas9-Gene-Edited Viruses
title_short Efficient Cross-Screening and Characterization of Monoclonal Antibodies against Marek’s Disease Specific Meq Oncoprotein Using CRISPR/Cas9-Gene-Edited Viruses
title_sort efficient cross-screening and characterization of monoclonal antibodies against marek’s disease specific meq oncoprotein using crispr/cas9-gene-edited viruses
topic Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10142107/
https://www.ncbi.nlm.nih.gov/pubmed/37112797
http://dx.doi.org/10.3390/v15040817
work_keys_str_mv AT tengman efficientcrossscreeningandcharacterizationofmonoclonalantibodiesagainstmareksdiseasespecificmeqoncoproteinusingcrisprcas9geneeditedviruses
AT liujinling efficientcrossscreeningandcharacterizationofmonoclonalantibodiesagainstmareksdiseasespecificmeqoncoproteinusingcrisprcas9geneeditedviruses
AT luoqin efficientcrossscreeningandcharacterizationofmonoclonalantibodiesagainstmareksdiseasespecificmeqoncoproteinusingcrisprcas9geneeditedviruses
AT zhengluping efficientcrossscreeningandcharacterizationofmonoclonalantibodiesagainstmareksdiseasespecificmeqoncoproteinusingcrisprcas9geneeditedviruses
AT yaoyongxiu efficientcrossscreeningandcharacterizationofmonoclonalantibodiesagainstmareksdiseasespecificmeqoncoproteinusingcrisprcas9geneeditedviruses
AT nairvenugopal efficientcrossscreeningandcharacterizationofmonoclonalantibodiesagainstmareksdiseasespecificmeqoncoproteinusingcrisprcas9geneeditedviruses
AT zhanggaiping efficientcrossscreeningandcharacterizationofmonoclonalantibodiesagainstmareksdiseasespecificmeqoncoproteinusingcrisprcas9geneeditedviruses
AT luojun efficientcrossscreeningandcharacterizationofmonoclonalantibodiesagainstmareksdiseasespecificmeqoncoproteinusingcrisprcas9geneeditedviruses