Cargando…
Meta-Analysis of Microarray Data and Their Utility in Dissecting the Mapped QTLs for Heat Acclimation in Rice
In the current global warming scenario, it is imperative to develop crops with improved heat tolerance or acclimation, for which knowledge of major heat stress-tolerant genes or genomic regions is a prerequisite. Though several quantitative trait loci (QTLs) for heat tolerance have been mapped in ri...
Autores principales: | , , , , , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
MDPI
2023
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10142300/ https://www.ncbi.nlm.nih.gov/pubmed/37111920 http://dx.doi.org/10.3390/plants12081697 |
_version_ | 1785033580171231232 |
---|---|
author | Singh, Bablee Kumari Venkadesan, Sureshkumar Ramkumar, M. K. Shanmugavadivel, P. S. Dutta, Bipratip Prakash, Chandra Pal, Madan Solanke, Amolkumar U. Rai, Anil Singh, Nagendra Kumar Mohapatra, Trilochan Sevanthi, Amitha Mithra |
author_facet | Singh, Bablee Kumari Venkadesan, Sureshkumar Ramkumar, M. K. Shanmugavadivel, P. S. Dutta, Bipratip Prakash, Chandra Pal, Madan Solanke, Amolkumar U. Rai, Anil Singh, Nagendra Kumar Mohapatra, Trilochan Sevanthi, Amitha Mithra |
author_sort | Singh, Bablee Kumari |
collection | PubMed |
description | In the current global warming scenario, it is imperative to develop crops with improved heat tolerance or acclimation, for which knowledge of major heat stress-tolerant genes or genomic regions is a prerequisite. Though several quantitative trait loci (QTLs) for heat tolerance have been mapped in rice, candidate genes from these QTLs have not been reported yet. The meta-analysis of microarray datasets for heat stress in rice can give us a better genomic resource for the dissection of QTLs and the identification of major candidate genes for heat stress tolerance. In the present study, a database, RiceMetaSys-H, comprising 4227 heat stress-responsive genes (HRGs), was created using seven publicly available microarray datasets. This included in-house-generated microarray datasets of Nagina 22 (N22) and IR64 subjected to 8 days of heat stress. The database has provisions for searching the HRGs through genotypes, growth stages, tissues, and physical intervals in the genome, as well as Locus IDs, which provide complete information on the HRGs with their annotations and fold changes, along with the experimental material used for the analysis. The up-regulation of genes involved in hormone biosynthesis and signalling, sugar metabolism, carbon fixation, and the ROS pathway were found to be the key mechanisms of enhanced heat tolerance. Integrating variant and expression analysis, the database was used for the dissection of the major effect of QTLs on chromosomes 4, 5, and 9 from the IR64/N22 mapping population. Out of the 18, 54, and 62 genes in these three QTLs, 5, 15, and 12 genes harboured non-synonymous substitutions. Fifty-seven interacting genes of the selected QTLs were identified by a network analysis of the HRGs in the QTL regions. Variant analysis revealed that the proportion of unique amino acid substitutions (between N22/IR64) in the QTL-specific genes was much higher than the common substitutions, i.e., 2.58:0.88 (2.93-fold), compared to the network genes at a 0.88:0.67 (1.313-fold) ratio. An expression analysis of these 89 genes showed 43 DEGs between IR64/N22. By integrating the expression profiles, allelic variations, and the database, four robust candidates (LOC_Os05g43870, LOC_Os09g27830, LOC_Os09g27650, andLOC_Os09g28000) for enhanced heat stress tolerance were identified. The database thus developed in rice can be used in breeding to combat high-temperature stress. |
format | Online Article Text |
id | pubmed-10142300 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2023 |
publisher | MDPI |
record_format | MEDLINE/PubMed |
spelling | pubmed-101423002023-04-29 Meta-Analysis of Microarray Data and Their Utility in Dissecting the Mapped QTLs for Heat Acclimation in Rice Singh, Bablee Kumari Venkadesan, Sureshkumar Ramkumar, M. K. Shanmugavadivel, P. S. Dutta, Bipratip Prakash, Chandra Pal, Madan Solanke, Amolkumar U. Rai, Anil Singh, Nagendra Kumar Mohapatra, Trilochan Sevanthi, Amitha Mithra Plants (Basel) Article In the current global warming scenario, it is imperative to develop crops with improved heat tolerance or acclimation, for which knowledge of major heat stress-tolerant genes or genomic regions is a prerequisite. Though several quantitative trait loci (QTLs) for heat tolerance have been mapped in rice, candidate genes from these QTLs have not been reported yet. The meta-analysis of microarray datasets for heat stress in rice can give us a better genomic resource for the dissection of QTLs and the identification of major candidate genes for heat stress tolerance. In the present study, a database, RiceMetaSys-H, comprising 4227 heat stress-responsive genes (HRGs), was created using seven publicly available microarray datasets. This included in-house-generated microarray datasets of Nagina 22 (N22) and IR64 subjected to 8 days of heat stress. The database has provisions for searching the HRGs through genotypes, growth stages, tissues, and physical intervals in the genome, as well as Locus IDs, which provide complete information on the HRGs with their annotations and fold changes, along with the experimental material used for the analysis. The up-regulation of genes involved in hormone biosynthesis and signalling, sugar metabolism, carbon fixation, and the ROS pathway were found to be the key mechanisms of enhanced heat tolerance. Integrating variant and expression analysis, the database was used for the dissection of the major effect of QTLs on chromosomes 4, 5, and 9 from the IR64/N22 mapping population. Out of the 18, 54, and 62 genes in these three QTLs, 5, 15, and 12 genes harboured non-synonymous substitutions. Fifty-seven interacting genes of the selected QTLs were identified by a network analysis of the HRGs in the QTL regions. Variant analysis revealed that the proportion of unique amino acid substitutions (between N22/IR64) in the QTL-specific genes was much higher than the common substitutions, i.e., 2.58:0.88 (2.93-fold), compared to the network genes at a 0.88:0.67 (1.313-fold) ratio. An expression analysis of these 89 genes showed 43 DEGs between IR64/N22. By integrating the expression profiles, allelic variations, and the database, four robust candidates (LOC_Os05g43870, LOC_Os09g27830, LOC_Os09g27650, andLOC_Os09g28000) for enhanced heat stress tolerance were identified. The database thus developed in rice can be used in breeding to combat high-temperature stress. MDPI 2023-04-18 /pmc/articles/PMC10142300/ /pubmed/37111920 http://dx.doi.org/10.3390/plants12081697 Text en © 2023 by the authors. https://creativecommons.org/licenses/by/4.0/Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (https://creativecommons.org/licenses/by/4.0/). |
spellingShingle | Article Singh, Bablee Kumari Venkadesan, Sureshkumar Ramkumar, M. K. Shanmugavadivel, P. S. Dutta, Bipratip Prakash, Chandra Pal, Madan Solanke, Amolkumar U. Rai, Anil Singh, Nagendra Kumar Mohapatra, Trilochan Sevanthi, Amitha Mithra Meta-Analysis of Microarray Data and Their Utility in Dissecting the Mapped QTLs for Heat Acclimation in Rice |
title | Meta-Analysis of Microarray Data and Their Utility in Dissecting the Mapped QTLs for Heat Acclimation in Rice |
title_full | Meta-Analysis of Microarray Data and Their Utility in Dissecting the Mapped QTLs for Heat Acclimation in Rice |
title_fullStr | Meta-Analysis of Microarray Data and Their Utility in Dissecting the Mapped QTLs for Heat Acclimation in Rice |
title_full_unstemmed | Meta-Analysis of Microarray Data and Their Utility in Dissecting the Mapped QTLs for Heat Acclimation in Rice |
title_short | Meta-Analysis of Microarray Data and Their Utility in Dissecting the Mapped QTLs for Heat Acclimation in Rice |
title_sort | meta-analysis of microarray data and their utility in dissecting the mapped qtls for heat acclimation in rice |
topic | Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10142300/ https://www.ncbi.nlm.nih.gov/pubmed/37111920 http://dx.doi.org/10.3390/plants12081697 |
work_keys_str_mv | AT singhbableekumari metaanalysisofmicroarraydataandtheirutilityindissectingthemappedqtlsforheatacclimationinrice AT venkadesansureshkumar metaanalysisofmicroarraydataandtheirutilityindissectingthemappedqtlsforheatacclimationinrice AT ramkumarmk metaanalysisofmicroarraydataandtheirutilityindissectingthemappedqtlsforheatacclimationinrice AT shanmugavadivelps metaanalysisofmicroarraydataandtheirutilityindissectingthemappedqtlsforheatacclimationinrice AT duttabipratip metaanalysisofmicroarraydataandtheirutilityindissectingthemappedqtlsforheatacclimationinrice AT prakashchandra metaanalysisofmicroarraydataandtheirutilityindissectingthemappedqtlsforheatacclimationinrice AT palmadan metaanalysisofmicroarraydataandtheirutilityindissectingthemappedqtlsforheatacclimationinrice AT solankeamolkumaru metaanalysisofmicroarraydataandtheirutilityindissectingthemappedqtlsforheatacclimationinrice AT raianil metaanalysisofmicroarraydataandtheirutilityindissectingthemappedqtlsforheatacclimationinrice AT singhnagendrakumar metaanalysisofmicroarraydataandtheirutilityindissectingthemappedqtlsforheatacclimationinrice AT mohapatratrilochan metaanalysisofmicroarraydataandtheirutilityindissectingthemappedqtlsforheatacclimationinrice AT sevanthiamithamithra metaanalysisofmicroarraydataandtheirutilityindissectingthemappedqtlsforheatacclimationinrice |