Cargando…
Tirzepatide Reduces Appetite, Energy Intake, and Fat Mass in People With Type 2 Diabetes
OBJECTIVE: To evaluate the effects of tirzepatide on body composition, appetite, and energy intake to address the potential mechanisms involved in body weight loss with tirzepatide. RESEARCH DESIGN AND METHODS: In a secondary analysis of a randomized, double-blind, parallel-arm study, the effects of...
Autores principales: | , , , , , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
American Diabetes Association
2023
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10154650/ https://www.ncbi.nlm.nih.gov/pubmed/36857477 http://dx.doi.org/10.2337/dc22-1710 |
_version_ | 1785036172675776512 |
---|---|
author | Heise, Tim DeVries, J. Hans Urva, Shweta Li, Jing Pratt, Edward J. Thomas, Melissa K. Mather, Kieren J. Karanikas, Chrisanthi A. Dunn, Julia Haupt, Axel Milicevic, Zvonko Coskun, Tamer |
author_facet | Heise, Tim DeVries, J. Hans Urva, Shweta Li, Jing Pratt, Edward J. Thomas, Melissa K. Mather, Kieren J. Karanikas, Chrisanthi A. Dunn, Julia Haupt, Axel Milicevic, Zvonko Coskun, Tamer |
author_sort | Heise, Tim |
collection | PubMed |
description | OBJECTIVE: To evaluate the effects of tirzepatide on body composition, appetite, and energy intake to address the potential mechanisms involved in body weight loss with tirzepatide. RESEARCH DESIGN AND METHODS: In a secondary analysis of a randomized, double-blind, parallel-arm study, the effects of tirzepatide 15 mg (N = 45), semaglutide 1 mg (N = 44), and placebo (N = 28) on body weight and composition, appetite, and energy intake were assessed at baseline and week 28. RESULTS: Tirzepatide treatment demonstrated significant reductions in body weight compared with placebo and semaglutide, resulting in greater fat mass reduction. Tirzepatide and semaglutide significantly reduced appetite versus placebo. Appetite scores and energy intake reductions did not differ between tirzepatide and semaglutide. CONCLUSIONS: Differences in energy intake during ad libitum lunch were not sufficient to explain the different weight outcomes. Further evaluation is needed to assess mechanistic differences related to tirzepatide actions on 24-h energy intake, substrate utilization, and energy expenditure. |
format | Online Article Text |
id | pubmed-10154650 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2023 |
publisher | American Diabetes Association |
record_format | MEDLINE/PubMed |
spelling | pubmed-101546502023-05-04 Tirzepatide Reduces Appetite, Energy Intake, and Fat Mass in People With Type 2 Diabetes Heise, Tim DeVries, J. Hans Urva, Shweta Li, Jing Pratt, Edward J. Thomas, Melissa K. Mather, Kieren J. Karanikas, Chrisanthi A. Dunn, Julia Haupt, Axel Milicevic, Zvonko Coskun, Tamer Diabetes Care Brief Report OBJECTIVE: To evaluate the effects of tirzepatide on body composition, appetite, and energy intake to address the potential mechanisms involved in body weight loss with tirzepatide. RESEARCH DESIGN AND METHODS: In a secondary analysis of a randomized, double-blind, parallel-arm study, the effects of tirzepatide 15 mg (N = 45), semaglutide 1 mg (N = 44), and placebo (N = 28) on body weight and composition, appetite, and energy intake were assessed at baseline and week 28. RESULTS: Tirzepatide treatment demonstrated significant reductions in body weight compared with placebo and semaglutide, resulting in greater fat mass reduction. Tirzepatide and semaglutide significantly reduced appetite versus placebo. Appetite scores and energy intake reductions did not differ between tirzepatide and semaglutide. CONCLUSIONS: Differences in energy intake during ad libitum lunch were not sufficient to explain the different weight outcomes. Further evaluation is needed to assess mechanistic differences related to tirzepatide actions on 24-h energy intake, substrate utilization, and energy expenditure. American Diabetes Association 2023-05 2023-03-01 /pmc/articles/PMC10154650/ /pubmed/36857477 http://dx.doi.org/10.2337/dc22-1710 Text en © 2023 by the American Diabetes Association https://www.diabetesjournals.org/journals/pages/licenseReaders may use this article as long as the work is properly cited, the use is educational and not for profit, and the work is not altered. More information is available at https://www.diabetesjournals.org/journals/pages/license. |
spellingShingle | Brief Report Heise, Tim DeVries, J. Hans Urva, Shweta Li, Jing Pratt, Edward J. Thomas, Melissa K. Mather, Kieren J. Karanikas, Chrisanthi A. Dunn, Julia Haupt, Axel Milicevic, Zvonko Coskun, Tamer Tirzepatide Reduces Appetite, Energy Intake, and Fat Mass in People With Type 2 Diabetes |
title | Tirzepatide Reduces Appetite, Energy Intake, and Fat Mass in People With Type 2 Diabetes |
title_full | Tirzepatide Reduces Appetite, Energy Intake, and Fat Mass in People With Type 2 Diabetes |
title_fullStr | Tirzepatide Reduces Appetite, Energy Intake, and Fat Mass in People With Type 2 Diabetes |
title_full_unstemmed | Tirzepatide Reduces Appetite, Energy Intake, and Fat Mass in People With Type 2 Diabetes |
title_short | Tirzepatide Reduces Appetite, Energy Intake, and Fat Mass in People With Type 2 Diabetes |
title_sort | tirzepatide reduces appetite, energy intake, and fat mass in people with type 2 diabetes |
topic | Brief Report |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10154650/ https://www.ncbi.nlm.nih.gov/pubmed/36857477 http://dx.doi.org/10.2337/dc22-1710 |
work_keys_str_mv | AT heisetim tirzepatidereducesappetiteenergyintakeandfatmassinpeoplewithtype2diabetes AT devriesjhans tirzepatidereducesappetiteenergyintakeandfatmassinpeoplewithtype2diabetes AT urvashweta tirzepatidereducesappetiteenergyintakeandfatmassinpeoplewithtype2diabetes AT lijing tirzepatidereducesappetiteenergyintakeandfatmassinpeoplewithtype2diabetes AT prattedwardj tirzepatidereducesappetiteenergyintakeandfatmassinpeoplewithtype2diabetes AT thomasmelissak tirzepatidereducesappetiteenergyintakeandfatmassinpeoplewithtype2diabetes AT matherkierenj tirzepatidereducesappetiteenergyintakeandfatmassinpeoplewithtype2diabetes AT karanikaschrisanthia tirzepatidereducesappetiteenergyintakeandfatmassinpeoplewithtype2diabetes AT dunnjulia tirzepatidereducesappetiteenergyintakeandfatmassinpeoplewithtype2diabetes AT hauptaxel tirzepatidereducesappetiteenergyintakeandfatmassinpeoplewithtype2diabetes AT miliceviczvonko tirzepatidereducesappetiteenergyintakeandfatmassinpeoplewithtype2diabetes AT coskuntamer tirzepatidereducesappetiteenergyintakeandfatmassinpeoplewithtype2diabetes |