Cargando…

Tirzepatide Reduces Appetite, Energy Intake, and Fat Mass in People With Type 2 Diabetes

OBJECTIVE: To evaluate the effects of tirzepatide on body composition, appetite, and energy intake to address the potential mechanisms involved in body weight loss with tirzepatide. RESEARCH DESIGN AND METHODS: In a secondary analysis of a randomized, double-blind, parallel-arm study, the effects of...

Descripción completa

Detalles Bibliográficos
Autores principales: Heise, Tim, DeVries, J. Hans, Urva, Shweta, Li, Jing, Pratt, Edward J., Thomas, Melissa K., Mather, Kieren J., Karanikas, Chrisanthi A., Dunn, Julia, Haupt, Axel, Milicevic, Zvonko, Coskun, Tamer
Formato: Online Artículo Texto
Lenguaje:English
Publicado: American Diabetes Association 2023
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10154650/
https://www.ncbi.nlm.nih.gov/pubmed/36857477
http://dx.doi.org/10.2337/dc22-1710
_version_ 1785036172675776512
author Heise, Tim
DeVries, J. Hans
Urva, Shweta
Li, Jing
Pratt, Edward J.
Thomas, Melissa K.
Mather, Kieren J.
Karanikas, Chrisanthi A.
Dunn, Julia
Haupt, Axel
Milicevic, Zvonko
Coskun, Tamer
author_facet Heise, Tim
DeVries, J. Hans
Urva, Shweta
Li, Jing
Pratt, Edward J.
Thomas, Melissa K.
Mather, Kieren J.
Karanikas, Chrisanthi A.
Dunn, Julia
Haupt, Axel
Milicevic, Zvonko
Coskun, Tamer
author_sort Heise, Tim
collection PubMed
description OBJECTIVE: To evaluate the effects of tirzepatide on body composition, appetite, and energy intake to address the potential mechanisms involved in body weight loss with tirzepatide. RESEARCH DESIGN AND METHODS: In a secondary analysis of a randomized, double-blind, parallel-arm study, the effects of tirzepatide 15 mg (N = 45), semaglutide 1 mg (N = 44), and placebo (N = 28) on body weight and composition, appetite, and energy intake were assessed at baseline and week 28. RESULTS: Tirzepatide treatment demonstrated significant reductions in body weight compared with placebo and semaglutide, resulting in greater fat mass reduction. Tirzepatide and semaglutide significantly reduced appetite versus placebo. Appetite scores and energy intake reductions did not differ between tirzepatide and semaglutide. CONCLUSIONS: Differences in energy intake during ad libitum lunch were not sufficient to explain the different weight outcomes. Further evaluation is needed to assess mechanistic differences related to tirzepatide actions on 24-h energy intake, substrate utilization, and energy expenditure.
format Online
Article
Text
id pubmed-10154650
institution National Center for Biotechnology Information
language English
publishDate 2023
publisher American Diabetes Association
record_format MEDLINE/PubMed
spelling pubmed-101546502023-05-04 Tirzepatide Reduces Appetite, Energy Intake, and Fat Mass in People With Type 2 Diabetes Heise, Tim DeVries, J. Hans Urva, Shweta Li, Jing Pratt, Edward J. Thomas, Melissa K. Mather, Kieren J. Karanikas, Chrisanthi A. Dunn, Julia Haupt, Axel Milicevic, Zvonko Coskun, Tamer Diabetes Care Brief Report OBJECTIVE: To evaluate the effects of tirzepatide on body composition, appetite, and energy intake to address the potential mechanisms involved in body weight loss with tirzepatide. RESEARCH DESIGN AND METHODS: In a secondary analysis of a randomized, double-blind, parallel-arm study, the effects of tirzepatide 15 mg (N = 45), semaglutide 1 mg (N = 44), and placebo (N = 28) on body weight and composition, appetite, and energy intake were assessed at baseline and week 28. RESULTS: Tirzepatide treatment demonstrated significant reductions in body weight compared with placebo and semaglutide, resulting in greater fat mass reduction. Tirzepatide and semaglutide significantly reduced appetite versus placebo. Appetite scores and energy intake reductions did not differ between tirzepatide and semaglutide. CONCLUSIONS: Differences in energy intake during ad libitum lunch were not sufficient to explain the different weight outcomes. Further evaluation is needed to assess mechanistic differences related to tirzepatide actions on 24-h energy intake, substrate utilization, and energy expenditure. American Diabetes Association 2023-05 2023-03-01 /pmc/articles/PMC10154650/ /pubmed/36857477 http://dx.doi.org/10.2337/dc22-1710 Text en © 2023 by the American Diabetes Association https://www.diabetesjournals.org/journals/pages/licenseReaders may use this article as long as the work is properly cited, the use is educational and not for profit, and the work is not altered. More information is available at https://www.diabetesjournals.org/journals/pages/license.
spellingShingle Brief Report
Heise, Tim
DeVries, J. Hans
Urva, Shweta
Li, Jing
Pratt, Edward J.
Thomas, Melissa K.
Mather, Kieren J.
Karanikas, Chrisanthi A.
Dunn, Julia
Haupt, Axel
Milicevic, Zvonko
Coskun, Tamer
Tirzepatide Reduces Appetite, Energy Intake, and Fat Mass in People With Type 2 Diabetes
title Tirzepatide Reduces Appetite, Energy Intake, and Fat Mass in People With Type 2 Diabetes
title_full Tirzepatide Reduces Appetite, Energy Intake, and Fat Mass in People With Type 2 Diabetes
title_fullStr Tirzepatide Reduces Appetite, Energy Intake, and Fat Mass in People With Type 2 Diabetes
title_full_unstemmed Tirzepatide Reduces Appetite, Energy Intake, and Fat Mass in People With Type 2 Diabetes
title_short Tirzepatide Reduces Appetite, Energy Intake, and Fat Mass in People With Type 2 Diabetes
title_sort tirzepatide reduces appetite, energy intake, and fat mass in people with type 2 diabetes
topic Brief Report
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10154650/
https://www.ncbi.nlm.nih.gov/pubmed/36857477
http://dx.doi.org/10.2337/dc22-1710
work_keys_str_mv AT heisetim tirzepatidereducesappetiteenergyintakeandfatmassinpeoplewithtype2diabetes
AT devriesjhans tirzepatidereducesappetiteenergyintakeandfatmassinpeoplewithtype2diabetes
AT urvashweta tirzepatidereducesappetiteenergyintakeandfatmassinpeoplewithtype2diabetes
AT lijing tirzepatidereducesappetiteenergyintakeandfatmassinpeoplewithtype2diabetes
AT prattedwardj tirzepatidereducesappetiteenergyintakeandfatmassinpeoplewithtype2diabetes
AT thomasmelissak tirzepatidereducesappetiteenergyintakeandfatmassinpeoplewithtype2diabetes
AT matherkierenj tirzepatidereducesappetiteenergyintakeandfatmassinpeoplewithtype2diabetes
AT karanikaschrisanthia tirzepatidereducesappetiteenergyintakeandfatmassinpeoplewithtype2diabetes
AT dunnjulia tirzepatidereducesappetiteenergyintakeandfatmassinpeoplewithtype2diabetes
AT hauptaxel tirzepatidereducesappetiteenergyintakeandfatmassinpeoplewithtype2diabetes
AT miliceviczvonko tirzepatidereducesappetiteenergyintakeandfatmassinpeoplewithtype2diabetes
AT coskuntamer tirzepatidereducesappetiteenergyintakeandfatmassinpeoplewithtype2diabetes