Cargando…
A novel lncRNA FPASL regulates fibroblast proliferation via the PI3K/AKT and MAPK signaling pathways in hypertrophic scar: FPASL regulates hypertrophic scar via the AKT and MAPK pathways
Hypertrophic scar is a problem for numerous patients, especially after burns, and is characterized by increased fibroblast proliferation and collagen deposition. Increasing evidence demonstrates that lncRNAs contribute to the development and progression of various diseases. However, the function of...
Autores principales: | , , , , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Oxford University Press
2022
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10157618/ https://www.ncbi.nlm.nih.gov/pubmed/36082934 http://dx.doi.org/10.3724/abbs.2022122 |
_version_ | 1785036792566644736 |
---|---|
author | Ma, Fang Shen, Jiangyong Zhang, Hui Zhang, Zhenghao Yang, Anning Xiong, Jiantuan jiao, Yun Bai, Zhigang Ma, Shengchao Zhang, Huiping Jiang, Yideng |
author_facet | Ma, Fang Shen, Jiangyong Zhang, Hui Zhang, Zhenghao Yang, Anning Xiong, Jiantuan jiao, Yun Bai, Zhigang Ma, Shengchao Zhang, Huiping Jiang, Yideng |
author_sort | Ma, Fang |
collection | PubMed |
description | Hypertrophic scar is a problem for numerous patients, especially after burns, and is characterized by increased fibroblast proliferation and collagen deposition. Increasing evidence demonstrates that lncRNAs contribute to the development and progression of various diseases. However, the function of lncRNAs in hypertrophic scar formation remains poorly characterized. In this study, a novel fibroblast proliferation-associated lncRNA, named lncRNA FPASL (MSTRG.389905.1), which is mainly localized in the cytoplasm, is found to be downregulated in hypertrophic scar, as detected by lncRNA microarray and qRT-PCR. The full-length FPASL is characterized and further investigation confirms that it has no protein-coding potential. FPASL knockdown in fibroblasts triggers fibroblast proliferation, whereas overexpression of FPASL directly attenuates the proliferation of fibroblasts. Furthermore, target genes of the differentially expressed lncRNAs in hypertrophic scars and the matched adjacent normal tissues are enriched in fibroblast proliferation signaling pathways, including the PI3K/AKT and MAPK signaling pathways, as determined by GO annotation and KEGG enrichment analysis. We also demonstrate that knockdown of FPASL activates the PI3K/AKT and MAPK signaling pathways, and specific inhibitors of the PI3K/AKT and MAPK signaling pathways can reverse the proliferation of fibroblasts promoted by FPASL knockdown. Our findings contribute to a better understanding of the role of lncRNAs in hypertrophic scar and suggest that FPASL may act as a potential novel therapeutic target for hypertrophic scar. |
format | Online Article Text |
id | pubmed-10157618 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2022 |
publisher | Oxford University Press |
record_format | MEDLINE/PubMed |
spelling | pubmed-101576182023-05-05 A novel lncRNA FPASL regulates fibroblast proliferation via the PI3K/AKT and MAPK signaling pathways in hypertrophic scar: FPASL regulates hypertrophic scar via the AKT and MAPK pathways Ma, Fang Shen, Jiangyong Zhang, Hui Zhang, Zhenghao Yang, Anning Xiong, Jiantuan jiao, Yun Bai, Zhigang Ma, Shengchao Zhang, Huiping Jiang, Yideng Acta Biochim Biophys Sin (Shanghai) Research Article Hypertrophic scar is a problem for numerous patients, especially after burns, and is characterized by increased fibroblast proliferation and collagen deposition. Increasing evidence demonstrates that lncRNAs contribute to the development and progression of various diseases. However, the function of lncRNAs in hypertrophic scar formation remains poorly characterized. In this study, a novel fibroblast proliferation-associated lncRNA, named lncRNA FPASL (MSTRG.389905.1), which is mainly localized in the cytoplasm, is found to be downregulated in hypertrophic scar, as detected by lncRNA microarray and qRT-PCR. The full-length FPASL is characterized and further investigation confirms that it has no protein-coding potential. FPASL knockdown in fibroblasts triggers fibroblast proliferation, whereas overexpression of FPASL directly attenuates the proliferation of fibroblasts. Furthermore, target genes of the differentially expressed lncRNAs in hypertrophic scars and the matched adjacent normal tissues are enriched in fibroblast proliferation signaling pathways, including the PI3K/AKT and MAPK signaling pathways, as determined by GO annotation and KEGG enrichment analysis. We also demonstrate that knockdown of FPASL activates the PI3K/AKT and MAPK signaling pathways, and specific inhibitors of the PI3K/AKT and MAPK signaling pathways can reverse the proliferation of fibroblasts promoted by FPASL knockdown. Our findings contribute to a better understanding of the role of lncRNAs in hypertrophic scar and suggest that FPASL may act as a potential novel therapeutic target for hypertrophic scar. Oxford University Press 2022-09-07 /pmc/articles/PMC10157618/ /pubmed/36082934 http://dx.doi.org/10.3724/abbs.2022122 Text en © The Author(s) 2021. https://creativecommons.org/licenses/by-nc/4.0/ This is an open access article distributed under the terms of the Creative Commons Attribution Non-Commercial License (https://creativecommons.org/licenses/by-nc/4.0/). |
spellingShingle | Research Article Ma, Fang Shen, Jiangyong Zhang, Hui Zhang, Zhenghao Yang, Anning Xiong, Jiantuan jiao, Yun Bai, Zhigang Ma, Shengchao Zhang, Huiping Jiang, Yideng A novel lncRNA FPASL regulates fibroblast proliferation via the PI3K/AKT and MAPK signaling pathways in hypertrophic scar: FPASL regulates hypertrophic scar via the AKT and MAPK pathways |
title | A novel lncRNA FPASL regulates fibroblast proliferation via the PI3K/AKT and MAPK signaling pathways in hypertrophic scar: FPASL regulates hypertrophic scar via the AKT and MAPK pathways |
title_full | A novel lncRNA FPASL regulates fibroblast proliferation via the PI3K/AKT and MAPK signaling pathways in hypertrophic scar: FPASL regulates hypertrophic scar via the AKT and MAPK pathways |
title_fullStr | A novel lncRNA FPASL regulates fibroblast proliferation via the PI3K/AKT and MAPK signaling pathways in hypertrophic scar: FPASL regulates hypertrophic scar via the AKT and MAPK pathways |
title_full_unstemmed | A novel lncRNA FPASL regulates fibroblast proliferation via the PI3K/AKT and MAPK signaling pathways in hypertrophic scar: FPASL regulates hypertrophic scar via the AKT and MAPK pathways |
title_short | A novel lncRNA FPASL regulates fibroblast proliferation via the PI3K/AKT and MAPK signaling pathways in hypertrophic scar: FPASL regulates hypertrophic scar via the AKT and MAPK pathways |
title_sort | novel lncrna fpasl regulates fibroblast proliferation via the pi3k/akt and mapk signaling pathways in hypertrophic scar: fpasl regulates hypertrophic scar via the akt and mapk pathways |
topic | Research Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10157618/ https://www.ncbi.nlm.nih.gov/pubmed/36082934 http://dx.doi.org/10.3724/abbs.2022122 |
work_keys_str_mv | AT mafang anovellncrnafpaslregulatesfibroblastproliferationviathepi3kaktandmapksignalingpathwaysinhypertrophicscarfpaslregulateshypertrophicscarviatheaktandmapkpathways AT shenjiangyong anovellncrnafpaslregulatesfibroblastproliferationviathepi3kaktandmapksignalingpathwaysinhypertrophicscarfpaslregulateshypertrophicscarviatheaktandmapkpathways AT zhanghui anovellncrnafpaslregulatesfibroblastproliferationviathepi3kaktandmapksignalingpathwaysinhypertrophicscarfpaslregulateshypertrophicscarviatheaktandmapkpathways AT zhangzhenghao anovellncrnafpaslregulatesfibroblastproliferationviathepi3kaktandmapksignalingpathwaysinhypertrophicscarfpaslregulateshypertrophicscarviatheaktandmapkpathways AT yanganning anovellncrnafpaslregulatesfibroblastproliferationviathepi3kaktandmapksignalingpathwaysinhypertrophicscarfpaslregulateshypertrophicscarviatheaktandmapkpathways AT xiongjiantuan anovellncrnafpaslregulatesfibroblastproliferationviathepi3kaktandmapksignalingpathwaysinhypertrophicscarfpaslregulateshypertrophicscarviatheaktandmapkpathways AT jiaoyun anovellncrnafpaslregulatesfibroblastproliferationviathepi3kaktandmapksignalingpathwaysinhypertrophicscarfpaslregulateshypertrophicscarviatheaktandmapkpathways AT baizhigang anovellncrnafpaslregulatesfibroblastproliferationviathepi3kaktandmapksignalingpathwaysinhypertrophicscarfpaslregulateshypertrophicscarviatheaktandmapkpathways AT mashengchao anovellncrnafpaslregulatesfibroblastproliferationviathepi3kaktandmapksignalingpathwaysinhypertrophicscarfpaslregulateshypertrophicscarviatheaktandmapkpathways AT zhanghuiping anovellncrnafpaslregulatesfibroblastproliferationviathepi3kaktandmapksignalingpathwaysinhypertrophicscarfpaslregulateshypertrophicscarviatheaktandmapkpathways AT jiangyideng anovellncrnafpaslregulatesfibroblastproliferationviathepi3kaktandmapksignalingpathwaysinhypertrophicscarfpaslregulateshypertrophicscarviatheaktandmapkpathways AT mafang novellncrnafpaslregulatesfibroblastproliferationviathepi3kaktandmapksignalingpathwaysinhypertrophicscarfpaslregulateshypertrophicscarviatheaktandmapkpathways AT shenjiangyong novellncrnafpaslregulatesfibroblastproliferationviathepi3kaktandmapksignalingpathwaysinhypertrophicscarfpaslregulateshypertrophicscarviatheaktandmapkpathways AT zhanghui novellncrnafpaslregulatesfibroblastproliferationviathepi3kaktandmapksignalingpathwaysinhypertrophicscarfpaslregulateshypertrophicscarviatheaktandmapkpathways AT zhangzhenghao novellncrnafpaslregulatesfibroblastproliferationviathepi3kaktandmapksignalingpathwaysinhypertrophicscarfpaslregulateshypertrophicscarviatheaktandmapkpathways AT yanganning novellncrnafpaslregulatesfibroblastproliferationviathepi3kaktandmapksignalingpathwaysinhypertrophicscarfpaslregulateshypertrophicscarviatheaktandmapkpathways AT xiongjiantuan novellncrnafpaslregulatesfibroblastproliferationviathepi3kaktandmapksignalingpathwaysinhypertrophicscarfpaslregulateshypertrophicscarviatheaktandmapkpathways AT jiaoyun novellncrnafpaslregulatesfibroblastproliferationviathepi3kaktandmapksignalingpathwaysinhypertrophicscarfpaslregulateshypertrophicscarviatheaktandmapkpathways AT baizhigang novellncrnafpaslregulatesfibroblastproliferationviathepi3kaktandmapksignalingpathwaysinhypertrophicscarfpaslregulateshypertrophicscarviatheaktandmapkpathways AT mashengchao novellncrnafpaslregulatesfibroblastproliferationviathepi3kaktandmapksignalingpathwaysinhypertrophicscarfpaslregulateshypertrophicscarviatheaktandmapkpathways AT zhanghuiping novellncrnafpaslregulatesfibroblastproliferationviathepi3kaktandmapksignalingpathwaysinhypertrophicscarfpaslregulateshypertrophicscarviatheaktandmapkpathways AT jiangyideng novellncrnafpaslregulatesfibroblastproliferationviathepi3kaktandmapksignalingpathwaysinhypertrophicscarfpaslregulateshypertrophicscarviatheaktandmapkpathways |