Cargando…

A novel lncRNA FPASL regulates fibroblast proliferation via the PI3K/AKT and MAPK signaling pathways in hypertrophic scar: FPASL regulates hypertrophic scar via the AKT and MAPK pathways

Hypertrophic scar is a problem for numerous patients, especially after burns, and is characterized by increased fibroblast proliferation and collagen deposition. Increasing evidence demonstrates that lncRNAs contribute to the development and progression of various diseases. However, the function of...

Descripción completa

Detalles Bibliográficos
Autores principales: Ma, Fang, Shen, Jiangyong, Zhang, Hui, Zhang, Zhenghao, Yang, Anning, Xiong, Jiantuan, jiao, Yun, Bai, Zhigang, Ma, Shengchao, Zhang, Huiping, Jiang, Yideng
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Oxford University Press 2022
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10157618/
https://www.ncbi.nlm.nih.gov/pubmed/36082934
http://dx.doi.org/10.3724/abbs.2022122
_version_ 1785036792566644736
author Ma, Fang
Shen, Jiangyong
Zhang, Hui
Zhang, Zhenghao
Yang, Anning
Xiong, Jiantuan
jiao, Yun
Bai, Zhigang
Ma, Shengchao
Zhang, Huiping
Jiang, Yideng
author_facet Ma, Fang
Shen, Jiangyong
Zhang, Hui
Zhang, Zhenghao
Yang, Anning
Xiong, Jiantuan
jiao, Yun
Bai, Zhigang
Ma, Shengchao
Zhang, Huiping
Jiang, Yideng
author_sort Ma, Fang
collection PubMed
description Hypertrophic scar is a problem for numerous patients, especially after burns, and is characterized by increased fibroblast proliferation and collagen deposition. Increasing evidence demonstrates that lncRNAs contribute to the development and progression of various diseases. However, the function of lncRNAs in hypertrophic scar formation remains poorly characterized. In this study, a novel fibroblast proliferation-associated lncRNA, named lncRNA FPASL (MSTRG.389905.1), which is mainly localized in the cytoplasm, is found to be downregulated in hypertrophic scar, as detected by lncRNA microarray and qRT-PCR. The full-length FPASL is characterized and further investigation confirms that it has no protein-coding potential. FPASL knockdown in fibroblasts triggers fibroblast proliferation, whereas overexpression of FPASL directly attenuates the proliferation of fibroblasts. Furthermore, target genes of the differentially expressed lncRNAs in hypertrophic scars and the matched adjacent normal tissues are enriched in fibroblast proliferation signaling pathways, including the PI3K/AKT and MAPK signaling pathways, as determined by GO annotation and KEGG enrichment analysis. We also demonstrate that knockdown of FPASL activates the PI3K/AKT and MAPK signaling pathways, and specific inhibitors of the PI3K/AKT and MAPK signaling pathways can reverse the proliferation of fibroblasts promoted by FPASL knockdown. Our findings contribute to a better understanding of the role of lncRNAs in hypertrophic scar and suggest that FPASL may act as a potential novel therapeutic target for hypertrophic scar.
format Online
Article
Text
id pubmed-10157618
institution National Center for Biotechnology Information
language English
publishDate 2022
publisher Oxford University Press
record_format MEDLINE/PubMed
spelling pubmed-101576182023-05-05 A novel lncRNA FPASL regulates fibroblast proliferation via the PI3K/AKT and MAPK signaling pathways in hypertrophic scar: FPASL regulates hypertrophic scar via the AKT and MAPK pathways Ma, Fang Shen, Jiangyong Zhang, Hui Zhang, Zhenghao Yang, Anning Xiong, Jiantuan jiao, Yun Bai, Zhigang Ma, Shengchao Zhang, Huiping Jiang, Yideng Acta Biochim Biophys Sin (Shanghai) Research Article Hypertrophic scar is a problem for numerous patients, especially after burns, and is characterized by increased fibroblast proliferation and collagen deposition. Increasing evidence demonstrates that lncRNAs contribute to the development and progression of various diseases. However, the function of lncRNAs in hypertrophic scar formation remains poorly characterized. In this study, a novel fibroblast proliferation-associated lncRNA, named lncRNA FPASL (MSTRG.389905.1), which is mainly localized in the cytoplasm, is found to be downregulated in hypertrophic scar, as detected by lncRNA microarray and qRT-PCR. The full-length FPASL is characterized and further investigation confirms that it has no protein-coding potential. FPASL knockdown in fibroblasts triggers fibroblast proliferation, whereas overexpression of FPASL directly attenuates the proliferation of fibroblasts. Furthermore, target genes of the differentially expressed lncRNAs in hypertrophic scars and the matched adjacent normal tissues are enriched in fibroblast proliferation signaling pathways, including the PI3K/AKT and MAPK signaling pathways, as determined by GO annotation and KEGG enrichment analysis. We also demonstrate that knockdown of FPASL activates the PI3K/AKT and MAPK signaling pathways, and specific inhibitors of the PI3K/AKT and MAPK signaling pathways can reverse the proliferation of fibroblasts promoted by FPASL knockdown. Our findings contribute to a better understanding of the role of lncRNAs in hypertrophic scar and suggest that FPASL may act as a potential novel therapeutic target for hypertrophic scar. Oxford University Press 2022-09-07 /pmc/articles/PMC10157618/ /pubmed/36082934 http://dx.doi.org/10.3724/abbs.2022122 Text en © The Author(s) 2021. https://creativecommons.org/licenses/by-nc/4.0/ This is an open access article distributed under the terms of the Creative Commons Attribution Non-Commercial License (https://creativecommons.org/licenses/by-nc/4.0/).
spellingShingle Research Article
Ma, Fang
Shen, Jiangyong
Zhang, Hui
Zhang, Zhenghao
Yang, Anning
Xiong, Jiantuan
jiao, Yun
Bai, Zhigang
Ma, Shengchao
Zhang, Huiping
Jiang, Yideng
A novel lncRNA FPASL regulates fibroblast proliferation via the PI3K/AKT and MAPK signaling pathways in hypertrophic scar: FPASL regulates hypertrophic scar via the AKT and MAPK pathways
title A novel lncRNA FPASL regulates fibroblast proliferation via the PI3K/AKT and MAPK signaling pathways in hypertrophic scar: FPASL regulates hypertrophic scar via the AKT and MAPK pathways
title_full A novel lncRNA FPASL regulates fibroblast proliferation via the PI3K/AKT and MAPK signaling pathways in hypertrophic scar: FPASL regulates hypertrophic scar via the AKT and MAPK pathways
title_fullStr A novel lncRNA FPASL regulates fibroblast proliferation via the PI3K/AKT and MAPK signaling pathways in hypertrophic scar: FPASL regulates hypertrophic scar via the AKT and MAPK pathways
title_full_unstemmed A novel lncRNA FPASL regulates fibroblast proliferation via the PI3K/AKT and MAPK signaling pathways in hypertrophic scar: FPASL regulates hypertrophic scar via the AKT and MAPK pathways
title_short A novel lncRNA FPASL regulates fibroblast proliferation via the PI3K/AKT and MAPK signaling pathways in hypertrophic scar: FPASL regulates hypertrophic scar via the AKT and MAPK pathways
title_sort novel lncrna fpasl regulates fibroblast proliferation via the pi3k/akt and mapk signaling pathways in hypertrophic scar: fpasl regulates hypertrophic scar via the akt and mapk pathways
topic Research Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10157618/
https://www.ncbi.nlm.nih.gov/pubmed/36082934
http://dx.doi.org/10.3724/abbs.2022122
work_keys_str_mv AT mafang anovellncrnafpaslregulatesfibroblastproliferationviathepi3kaktandmapksignalingpathwaysinhypertrophicscarfpaslregulateshypertrophicscarviatheaktandmapkpathways
AT shenjiangyong anovellncrnafpaslregulatesfibroblastproliferationviathepi3kaktandmapksignalingpathwaysinhypertrophicscarfpaslregulateshypertrophicscarviatheaktandmapkpathways
AT zhanghui anovellncrnafpaslregulatesfibroblastproliferationviathepi3kaktandmapksignalingpathwaysinhypertrophicscarfpaslregulateshypertrophicscarviatheaktandmapkpathways
AT zhangzhenghao anovellncrnafpaslregulatesfibroblastproliferationviathepi3kaktandmapksignalingpathwaysinhypertrophicscarfpaslregulateshypertrophicscarviatheaktandmapkpathways
AT yanganning anovellncrnafpaslregulatesfibroblastproliferationviathepi3kaktandmapksignalingpathwaysinhypertrophicscarfpaslregulateshypertrophicscarviatheaktandmapkpathways
AT xiongjiantuan anovellncrnafpaslregulatesfibroblastproliferationviathepi3kaktandmapksignalingpathwaysinhypertrophicscarfpaslregulateshypertrophicscarviatheaktandmapkpathways
AT jiaoyun anovellncrnafpaslregulatesfibroblastproliferationviathepi3kaktandmapksignalingpathwaysinhypertrophicscarfpaslregulateshypertrophicscarviatheaktandmapkpathways
AT baizhigang anovellncrnafpaslregulatesfibroblastproliferationviathepi3kaktandmapksignalingpathwaysinhypertrophicscarfpaslregulateshypertrophicscarviatheaktandmapkpathways
AT mashengchao anovellncrnafpaslregulatesfibroblastproliferationviathepi3kaktandmapksignalingpathwaysinhypertrophicscarfpaslregulateshypertrophicscarviatheaktandmapkpathways
AT zhanghuiping anovellncrnafpaslregulatesfibroblastproliferationviathepi3kaktandmapksignalingpathwaysinhypertrophicscarfpaslregulateshypertrophicscarviatheaktandmapkpathways
AT jiangyideng anovellncrnafpaslregulatesfibroblastproliferationviathepi3kaktandmapksignalingpathwaysinhypertrophicscarfpaslregulateshypertrophicscarviatheaktandmapkpathways
AT mafang novellncrnafpaslregulatesfibroblastproliferationviathepi3kaktandmapksignalingpathwaysinhypertrophicscarfpaslregulateshypertrophicscarviatheaktandmapkpathways
AT shenjiangyong novellncrnafpaslregulatesfibroblastproliferationviathepi3kaktandmapksignalingpathwaysinhypertrophicscarfpaslregulateshypertrophicscarviatheaktandmapkpathways
AT zhanghui novellncrnafpaslregulatesfibroblastproliferationviathepi3kaktandmapksignalingpathwaysinhypertrophicscarfpaslregulateshypertrophicscarviatheaktandmapkpathways
AT zhangzhenghao novellncrnafpaslregulatesfibroblastproliferationviathepi3kaktandmapksignalingpathwaysinhypertrophicscarfpaslregulateshypertrophicscarviatheaktandmapkpathways
AT yanganning novellncrnafpaslregulatesfibroblastproliferationviathepi3kaktandmapksignalingpathwaysinhypertrophicscarfpaslregulateshypertrophicscarviatheaktandmapkpathways
AT xiongjiantuan novellncrnafpaslregulatesfibroblastproliferationviathepi3kaktandmapksignalingpathwaysinhypertrophicscarfpaslregulateshypertrophicscarviatheaktandmapkpathways
AT jiaoyun novellncrnafpaslregulatesfibroblastproliferationviathepi3kaktandmapksignalingpathwaysinhypertrophicscarfpaslregulateshypertrophicscarviatheaktandmapkpathways
AT baizhigang novellncrnafpaslregulatesfibroblastproliferationviathepi3kaktandmapksignalingpathwaysinhypertrophicscarfpaslregulateshypertrophicscarviatheaktandmapkpathways
AT mashengchao novellncrnafpaslregulatesfibroblastproliferationviathepi3kaktandmapksignalingpathwaysinhypertrophicscarfpaslregulateshypertrophicscarviatheaktandmapkpathways
AT zhanghuiping novellncrnafpaslregulatesfibroblastproliferationviathepi3kaktandmapksignalingpathwaysinhypertrophicscarfpaslregulateshypertrophicscarviatheaktandmapkpathways
AT jiangyideng novellncrnafpaslregulatesfibroblastproliferationviathepi3kaktandmapksignalingpathwaysinhypertrophicscarfpaslregulateshypertrophicscarviatheaktandmapkpathways