Cargando…
Association between vitamin D level and pediatric inflammatory bowel disease: A systematic review and meta-analysis
BACKGROUND: Previous studies have reported that the incidence of pediatric inflammatory bowel disease (IBD) is related to vitamin D, but it is still unclear. This study intends to calculate the relationship between pediatric IBD and vitamin D. METHODS: A comprehensive literature search from inceptio...
Autores principales: | , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Frontiers Media S.A.
2023
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10164952/ https://www.ncbi.nlm.nih.gov/pubmed/37168807 http://dx.doi.org/10.3389/fped.2023.1155004 |
_version_ | 1785038159666479104 |
---|---|
author | Sun, Yan-hong Tian, Dan-dan Zhou, Jian-ming Ye, Qing |
author_facet | Sun, Yan-hong Tian, Dan-dan Zhou, Jian-ming Ye, Qing |
author_sort | Sun, Yan-hong |
collection | PubMed |
description | BACKGROUND: Previous studies have reported that the incidence of pediatric inflammatory bowel disease (IBD) is related to vitamin D, but it is still unclear. This study intends to calculate the relationship between pediatric IBD and vitamin D. METHODS: A comprehensive literature search from inception to January 2023 was performed in the PubMed, EMBASE, Medline, Web of Science, and Google Scholar databases. Relevant data were extracted as required and used for subsequent calculations. RESULTS: Sixteen papers were included, and there was no significant difference between the average vitamin D level in IBD patients and healthy controls. In addition, the overall pooled results showed that C-reactive protein (CRP) was 2.65 higher before vitamin D supplementation than after supplementation [SMD = 2.65, 95% CI = (2.26, 3.04)]. Moreover, patients with IBD in remission were 0.72 higher before vitamin D supplementation than after supplementation [OR = 0.72, 95% CI = (0.52, 1.00)]. CONCLUSION: This study suggested that there was no obvious relationship between pediatric IBD and vitamin D, while vitamin D supplementation can improve disease activity. Therefore, follow-up still needs many prospective studies to confirm the relationship between pediatric IBD and vitamin D. |
format | Online Article Text |
id | pubmed-10164952 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2023 |
publisher | Frontiers Media S.A. |
record_format | MEDLINE/PubMed |
spelling | pubmed-101649522023-05-09 Association between vitamin D level and pediatric inflammatory bowel disease: A systematic review and meta-analysis Sun, Yan-hong Tian, Dan-dan Zhou, Jian-ming Ye, Qing Front Pediatr Pediatrics BACKGROUND: Previous studies have reported that the incidence of pediatric inflammatory bowel disease (IBD) is related to vitamin D, but it is still unclear. This study intends to calculate the relationship between pediatric IBD and vitamin D. METHODS: A comprehensive literature search from inception to January 2023 was performed in the PubMed, EMBASE, Medline, Web of Science, and Google Scholar databases. Relevant data were extracted as required and used for subsequent calculations. RESULTS: Sixteen papers were included, and there was no significant difference between the average vitamin D level in IBD patients and healthy controls. In addition, the overall pooled results showed that C-reactive protein (CRP) was 2.65 higher before vitamin D supplementation than after supplementation [SMD = 2.65, 95% CI = (2.26, 3.04)]. Moreover, patients with IBD in remission were 0.72 higher before vitamin D supplementation than after supplementation [OR = 0.72, 95% CI = (0.52, 1.00)]. CONCLUSION: This study suggested that there was no obvious relationship between pediatric IBD and vitamin D, while vitamin D supplementation can improve disease activity. Therefore, follow-up still needs many prospective studies to confirm the relationship between pediatric IBD and vitamin D. Frontiers Media S.A. 2023-04-24 /pmc/articles/PMC10164952/ /pubmed/37168807 http://dx.doi.org/10.3389/fped.2023.1155004 Text en © 2023 Sun, Tian, Zhou and Ye. https://creativecommons.org/licenses/by/4.0/This is an open-access article distributed under the terms of the Creative Commons Attribution License (CC BY) (https://creativecommons.org/licenses/by/4.0/) . The use, distribution or reproduction in other forums is permitted, provided the original author(s) and the copyright owner(s) are credited and that the original publication in this journal is cited, in accordance with accepted academic practice. No use, distribution or reproduction is permitted which does not comply with these terms. |
spellingShingle | Pediatrics Sun, Yan-hong Tian, Dan-dan Zhou, Jian-ming Ye, Qing Association between vitamin D level and pediatric inflammatory bowel disease: A systematic review and meta-analysis |
title | Association between vitamin D level and pediatric inflammatory bowel disease: A systematic review and meta-analysis |
title_full | Association between vitamin D level and pediatric inflammatory bowel disease: A systematic review and meta-analysis |
title_fullStr | Association between vitamin D level and pediatric inflammatory bowel disease: A systematic review and meta-analysis |
title_full_unstemmed | Association between vitamin D level and pediatric inflammatory bowel disease: A systematic review and meta-analysis |
title_short | Association between vitamin D level and pediatric inflammatory bowel disease: A systematic review and meta-analysis |
title_sort | association between vitamin d level and pediatric inflammatory bowel disease: a systematic review and meta-analysis |
topic | Pediatrics |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10164952/ https://www.ncbi.nlm.nih.gov/pubmed/37168807 http://dx.doi.org/10.3389/fped.2023.1155004 |
work_keys_str_mv | AT sunyanhong associationbetweenvitamindlevelandpediatricinflammatoryboweldiseaseasystematicreviewandmetaanalysis AT tiandandan associationbetweenvitamindlevelandpediatricinflammatoryboweldiseaseasystematicreviewandmetaanalysis AT zhoujianming associationbetweenvitamindlevelandpediatricinflammatoryboweldiseaseasystematicreviewandmetaanalysis AT yeqing associationbetweenvitamindlevelandpediatricinflammatoryboweldiseaseasystematicreviewandmetaanalysis |