Cargando…
High-throughput functional mapping of variants in an arrhythmia gene, KCNE1, reveals novel biology
BACKGROUND: KCNE1 encodes a 129-residue cardiac potassium channel (I(Ks)) subunit. KCNE1 variants are associated with long QT syndrome and atrial fibrillation. However, most variants have insufficient evidence of clinical consequences and thus limited clinical utility. RESULTS: Here, we demonstrate...
Autores principales: | , , , , , , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Cold Spring Harbor Laboratory
2023
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10168370/ https://www.ncbi.nlm.nih.gov/pubmed/37162834 http://dx.doi.org/10.1101/2023.04.28.538612 |
_version_ | 1785038841770409984 |
---|---|
author | Muhammad, Ayesha Calandranis, Maria E. Li, Bian Yang, Tao Blackwell, Daniel J. Harvey, M. Lorena Smith, Jeremy E. Chew, Ashli E. Capra, John A. Matreyek, Kenneth A. Fowler, Douglas M. Roden, Dan M. Glazer, Andrew M. |
author_facet | Muhammad, Ayesha Calandranis, Maria E. Li, Bian Yang, Tao Blackwell, Daniel J. Harvey, M. Lorena Smith, Jeremy E. Chew, Ashli E. Capra, John A. Matreyek, Kenneth A. Fowler, Douglas M. Roden, Dan M. Glazer, Andrew M. |
author_sort | Muhammad, Ayesha |
collection | PubMed |
description | BACKGROUND: KCNE1 encodes a 129-residue cardiac potassium channel (I(Ks)) subunit. KCNE1 variants are associated with long QT syndrome and atrial fibrillation. However, most variants have insufficient evidence of clinical consequences and thus limited clinical utility. RESULTS: Here, we demonstrate the power of variant effect mapping, which couples saturation mutagenesis with high-throughput sequencing, to ascertain the function of thousands of protein coding KCNE1 variants. We comprehensively assayed KCNE1 variant cell surface expression (2,554/2,709 possible single amino acid variants) and function (2,539 variants). We identified 470 loss-of-surface expression and 588 loss-of-function variants. Out of the 588 loss-of-function variants, only 155 had low cell surface expression. The latter half of the protein is dispensable for protein trafficking but essential for channel function. 22 of the 30 KCNE1 residues (73%) highly intolerant of variation were in predicted close contact with binding partners KCNQ1 or calmodulin. Our data were highly concordant with gold standard electrophysiological data (ρ = −0.65), population and patient cohorts (32/38 concordant variants), and computational metrics (ρ = −0.55). Our data provide moderate-strength evidence for the ACMG/AMP functional criteria for benign and pathogenic variants. CONCLUSIONS: Comprehensive variant effect maps of KCNE1 can both provide insight into I(Ks) channel biology and help reclassify variants of uncertain significance. |
format | Online Article Text |
id | pubmed-10168370 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2023 |
publisher | Cold Spring Harbor Laboratory |
record_format | MEDLINE/PubMed |
spelling | pubmed-101683702023-05-10 High-throughput functional mapping of variants in an arrhythmia gene, KCNE1, reveals novel biology Muhammad, Ayesha Calandranis, Maria E. Li, Bian Yang, Tao Blackwell, Daniel J. Harvey, M. Lorena Smith, Jeremy E. Chew, Ashli E. Capra, John A. Matreyek, Kenneth A. Fowler, Douglas M. Roden, Dan M. Glazer, Andrew M. bioRxiv Article BACKGROUND: KCNE1 encodes a 129-residue cardiac potassium channel (I(Ks)) subunit. KCNE1 variants are associated with long QT syndrome and atrial fibrillation. However, most variants have insufficient evidence of clinical consequences and thus limited clinical utility. RESULTS: Here, we demonstrate the power of variant effect mapping, which couples saturation mutagenesis with high-throughput sequencing, to ascertain the function of thousands of protein coding KCNE1 variants. We comprehensively assayed KCNE1 variant cell surface expression (2,554/2,709 possible single amino acid variants) and function (2,539 variants). We identified 470 loss-of-surface expression and 588 loss-of-function variants. Out of the 588 loss-of-function variants, only 155 had low cell surface expression. The latter half of the protein is dispensable for protein trafficking but essential for channel function. 22 of the 30 KCNE1 residues (73%) highly intolerant of variation were in predicted close contact with binding partners KCNQ1 or calmodulin. Our data were highly concordant with gold standard electrophysiological data (ρ = −0.65), population and patient cohorts (32/38 concordant variants), and computational metrics (ρ = −0.55). Our data provide moderate-strength evidence for the ACMG/AMP functional criteria for benign and pathogenic variants. CONCLUSIONS: Comprehensive variant effect maps of KCNE1 can both provide insight into I(Ks) channel biology and help reclassify variants of uncertain significance. Cold Spring Harbor Laboratory 2023-04-29 /pmc/articles/PMC10168370/ /pubmed/37162834 http://dx.doi.org/10.1101/2023.04.28.538612 Text en https://creativecommons.org/licenses/by-nc-nd/4.0/This work is licensed under a Creative Commons Attribution-NonCommercial-NoDerivatives 4.0 International License (https://creativecommons.org/licenses/by-nc-nd/4.0/) , which allows reusers to copy and distribute the material in any medium or format in unadapted form only, for noncommercial purposes only, and only so long as attribution is given to the creator. |
spellingShingle | Article Muhammad, Ayesha Calandranis, Maria E. Li, Bian Yang, Tao Blackwell, Daniel J. Harvey, M. Lorena Smith, Jeremy E. Chew, Ashli E. Capra, John A. Matreyek, Kenneth A. Fowler, Douglas M. Roden, Dan M. Glazer, Andrew M. High-throughput functional mapping of variants in an arrhythmia gene, KCNE1, reveals novel biology |
title | High-throughput functional mapping of variants in an arrhythmia gene, KCNE1, reveals novel biology |
title_full | High-throughput functional mapping of variants in an arrhythmia gene, KCNE1, reveals novel biology |
title_fullStr | High-throughput functional mapping of variants in an arrhythmia gene, KCNE1, reveals novel biology |
title_full_unstemmed | High-throughput functional mapping of variants in an arrhythmia gene, KCNE1, reveals novel biology |
title_short | High-throughput functional mapping of variants in an arrhythmia gene, KCNE1, reveals novel biology |
title_sort | high-throughput functional mapping of variants in an arrhythmia gene, kcne1, reveals novel biology |
topic | Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10168370/ https://www.ncbi.nlm.nih.gov/pubmed/37162834 http://dx.doi.org/10.1101/2023.04.28.538612 |
work_keys_str_mv | AT muhammadayesha highthroughputfunctionalmappingofvariantsinanarrhythmiagenekcne1revealsnovelbiology AT calandranismariae highthroughputfunctionalmappingofvariantsinanarrhythmiagenekcne1revealsnovelbiology AT libian highthroughputfunctionalmappingofvariantsinanarrhythmiagenekcne1revealsnovelbiology AT yangtao highthroughputfunctionalmappingofvariantsinanarrhythmiagenekcne1revealsnovelbiology AT blackwelldanielj highthroughputfunctionalmappingofvariantsinanarrhythmiagenekcne1revealsnovelbiology AT harveymlorena highthroughputfunctionalmappingofvariantsinanarrhythmiagenekcne1revealsnovelbiology AT smithjeremye highthroughputfunctionalmappingofvariantsinanarrhythmiagenekcne1revealsnovelbiology AT chewashlie highthroughputfunctionalmappingofvariantsinanarrhythmiagenekcne1revealsnovelbiology AT caprajohna highthroughputfunctionalmappingofvariantsinanarrhythmiagenekcne1revealsnovelbiology AT matreyekkennetha highthroughputfunctionalmappingofvariantsinanarrhythmiagenekcne1revealsnovelbiology AT fowlerdouglasm highthroughputfunctionalmappingofvariantsinanarrhythmiagenekcne1revealsnovelbiology AT rodendanm highthroughputfunctionalmappingofvariantsinanarrhythmiagenekcne1revealsnovelbiology AT glazerandrewm highthroughputfunctionalmappingofvariantsinanarrhythmiagenekcne1revealsnovelbiology |