Bilateral swelling of the salivary glands and sicca symptoms: an unusual differential diagnosis—Kimura’s disease, a rare allergic condition with a high IgE serum level—a case report and review of the literature

A 68-year-old woman presented with bilateral swelling of the salivary glands, sicca symptoms of eyes and mouth, itching, fatigue and weight gain of about 5 kg in the last 2–3 years. As part of a careful diagnostic work up including lab tests for antinuclear antibodies (ANA), antibodies to extractabl...

Descripción completa

Detalles Bibliográficos
Autores principales: Braun, Jüergen, Mairinger, Thomas, Kaschke, Oliver, Behrendt, Kai, Ramsbacher, Josef, Karberg, Kirsten
Formato: Online Artículo Texto
Lenguaje:English
Publicado: BMJ Publishing Group 2023
Materias:
Sjögren Syndrome
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10173963/
https://www.ncbi.nlm.nih.gov/pubmed/37164447
http://dx.doi.org/10.1136/rmdopen-2023-003135
_version_ 1785039935963660288
author Braun, Jüergen
Mairinger, Thomas
Kaschke, Oliver
Behrendt, Kai
Ramsbacher, Josef
Karberg, Kirsten
author_facet Braun, Jüergen
Mairinger, Thomas
Kaschke, Oliver
Behrendt, Kai
Ramsbacher, Josef
Karberg, Kirsten
author_sort Braun, Jüergen
collection PubMed
description A 68-year-old woman presented with bilateral swelling of the salivary glands, sicca symptoms of eyes and mouth, itching, fatigue and weight gain of about 5 kg in the last 2–3 years. As part of a careful diagnostic work up including lab tests for antinuclear antibodies (ANA), antibodies to extractable nuclear antigens (ENA), anti-neutrophilic cytoplasmatic antiobodies (ANCA), immunoglobulin (Ig)G4, a whole body computed tomography (CT) and a parotid biopsy several rheumatic diseases such as Sjoegren’s syndrome, IgG4-related disease and sarcoidosis were ruled out and, considering a very high titre of IgE, Kimura’s disease was diagnosed. The case and a short review of the literature are presented.
format Online
Article
Text
id pubmed-10173963
institution National Center for Biotechnology Information
language English
publishDate 2023
publisher BMJ Publishing Group
record_format MEDLINE/PubMed
spelling pubmed-101739632023-05-12 Bilateral swelling of the salivary glands and sicca symptoms: an unusual differential diagnosis—Kimura’s disease, a rare allergic condition with a high IgE serum level—a case report and review of the literature Braun, Jüergen Mairinger, Thomas Kaschke, Oliver Behrendt, Kai Ramsbacher, Josef Karberg, Kirsten RMD Open Sjögren Syndrome A 68-year-old woman presented with bilateral swelling of the salivary glands, sicca symptoms of eyes and mouth, itching, fatigue and weight gain of about 5 kg in the last 2–3 years. As part of a careful diagnostic work up including lab tests for antinuclear antibodies (ANA), antibodies to extractable nuclear antigens (ENA), anti-neutrophilic cytoplasmatic antiobodies (ANCA), immunoglobulin (Ig)G4, a whole body computed tomography (CT) and a parotid biopsy several rheumatic diseases such as Sjoegren’s syndrome, IgG4-related disease and sarcoidosis were ruled out and, considering a very high titre of IgE, Kimura’s disease was diagnosed. The case and a short review of the literature are presented. BMJ Publishing Group 2023-05-10 /pmc/articles/PMC10173963/ /pubmed/37164447 http://dx.doi.org/10.1136/rmdopen-2023-003135 Text en © Author(s) (or their employer(s)) 2023. Re-use permitted under CC BY-NC. No commercial re-use. See rights and permissions. Published by BMJ. https://creativecommons.org/licenses/by-nc/4.0/This is an open access article distributed in accordance with the Creative Commons Attribution Non Commercial (CC BY-NC 4.0) license, which permits others to distribute, remix, adapt, build upon this work non-commercially, and license their derivative works on different terms, provided the original work is properly cited, appropriate credit is given, any changes made indicated, and the use is non-commercial. See: http://creativecommons.org/licenses/by-nc/4.0/ (https://creativecommons.org/licenses/by-nc/4.0/) .
spellingShingle Sjögren Syndrome
Braun, Jüergen
Mairinger, Thomas
Kaschke, Oliver
Behrendt, Kai
Ramsbacher, Josef
Karberg, Kirsten
Bilateral swelling of the salivary glands and sicca symptoms: an unusual differential diagnosis—Kimura’s disease, a rare allergic condition with a high IgE serum level—a case report and review of the literature
title Bilateral swelling of the salivary glands and sicca symptoms: an unusual differential diagnosis—Kimura’s disease, a rare allergic condition with a high IgE serum level—a case report and review of the literature
title_full Bilateral swelling of the salivary glands and sicca symptoms: an unusual differential diagnosis—Kimura’s disease, a rare allergic condition with a high IgE serum level—a case report and review of the literature
title_fullStr Bilateral swelling of the salivary glands and sicca symptoms: an unusual differential diagnosis—Kimura’s disease, a rare allergic condition with a high IgE serum level—a case report and review of the literature
title_full_unstemmed Bilateral swelling of the salivary glands and sicca symptoms: an unusual differential diagnosis—Kimura’s disease, a rare allergic condition with a high IgE serum level—a case report and review of the literature
title_short Bilateral swelling of the salivary glands and sicca symptoms: an unusual differential diagnosis—Kimura’s disease, a rare allergic condition with a high IgE serum level—a case report and review of the literature
title_sort bilateral swelling of the salivary glands and sicca symptoms: an unusual differential diagnosis—kimura’s disease, a rare allergic condition with a high ige serum level—a case report and review of the literature
topic Sjögren Syndrome
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10173963/
https://www.ncbi.nlm.nih.gov/pubmed/37164447
http://dx.doi.org/10.1136/rmdopen-2023-003135
work_keys_str_mv AT braunjuergen bilateralswellingofthesalivaryglandsandsiccasymptomsanunusualdifferentialdiagnosiskimurasdiseasearareallergicconditionwithahighigeserumlevelacasereportandreviewoftheliterature
AT mairingerthomas bilateralswellingofthesalivaryglandsandsiccasymptomsanunusualdifferentialdiagnosiskimurasdiseasearareallergicconditionwithahighigeserumlevelacasereportandreviewoftheliterature
AT kaschkeoliver bilateralswellingofthesalivaryglandsandsiccasymptomsanunusualdifferentialdiagnosiskimurasdiseasearareallergicconditionwithahighigeserumlevelacasereportandreviewoftheliterature
AT behrendtkai bilateralswellingofthesalivaryglandsandsiccasymptomsanunusualdifferentialdiagnosiskimurasdiseasearareallergicconditionwithahighigeserumlevelacasereportandreviewoftheliterature
AT ramsbacherjosef bilateralswellingofthesalivaryglandsandsiccasymptomsanunusualdifferentialdiagnosiskimurasdiseasearareallergicconditionwithahighigeserumlevelacasereportandreviewoftheliterature
AT karbergkirsten bilateralswellingofthesalivaryglandsandsiccasymptomsanunusualdifferentialdiagnosiskimurasdiseasearareallergicconditionwithahighigeserumlevelacasereportandreviewoftheliterature

Ejemplares similares