Cargando…
Clinical practice guidelines for the antenatal management of dichorionic diamniotic twin pregnancies: a systematic review
OBJECTIVE: This review aimed to identify guidelines with recommendations applicable to the antenatal management of dichorionic diamniotic twin pregnancies within high-income countries, appraise their methodological quality, and discuss the similarities and variability across guidelines. METHOD: A sy...
Autores principales: | , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
BioMed Central
2023
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10182673/ https://www.ncbi.nlm.nih.gov/pubmed/37179347 http://dx.doi.org/10.1186/s12884-023-05652-z |
_version_ | 1785041804600541184 |
---|---|
author | O’Connor, Caroline O’Connor, Emily Leitao, Sara Barrett, Shauna O’Donoghue, Keelin |
author_facet | O’Connor, Caroline O’Connor, Emily Leitao, Sara Barrett, Shauna O’Donoghue, Keelin |
author_sort | O’Connor, Caroline |
collection | PubMed |
description | OBJECTIVE: This review aimed to identify guidelines with recommendations applicable to the antenatal management of dichorionic diamniotic twin pregnancies within high-income countries, appraise their methodological quality, and discuss the similarities and variability across guidelines. METHOD: A systematic literature review of electronic databases was performed. Manual searches of guideline repositories and websites of professional organisations were performed to identify additional guidelines. The protocol for this systematic review was registered on PROSPERO (CRD42021248586, 25 June 2021). AGREE II and AGREE-REX tools were applied to assess the quality of eligible guidelines. A narrative and thematic synthesis described and compared the guidelines and their recommendations. RESULTS: Twenty-four guidelines were included, from which 483 recommendations were identified across 4 international organisations and 12 countries. Guidelines addressed eight themes and recommendations were classified accordingly: chorionicity and dating (103 recommendations), fetal growth (105 recommendations), termination of pregnancy (12 recommendations), fetal death (13 recommendations), fetal anomalies (65 recommendations), antenatal care (65 recommendations), preterm labour (56 recommendations) and birth (54 recommendations). Guidelines showed significant variability in recommendations, with conflicting recommendations regarding non-invasive preterm testing, definitions surrounding selective fetal growth restriction, screening for preterm labour and the timing of birth. Guidelines lacked a focus on standard antenatal management of DCDA twins, management of discordant fetal anomaly and single fetal demise. CONCLUSIONS: Specific guidance for dichorionic diamniotic twins is overall indistinct and access to guidance regarding the antenatal management of these pregnancies is currently difficult. Management of discordant fetal anomaly or single fetal demise needs greater consideration. SUPPLEMENTARY INFORMATION: The online version contains supplementary material available at 10.1186/s12884-023-05652-z. |
format | Online Article Text |
id | pubmed-10182673 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2023 |
publisher | BioMed Central |
record_format | MEDLINE/PubMed |
spelling | pubmed-101826732023-05-14 Clinical practice guidelines for the antenatal management of dichorionic diamniotic twin pregnancies: a systematic review O’Connor, Caroline O’Connor, Emily Leitao, Sara Barrett, Shauna O’Donoghue, Keelin BMC Pregnancy Childbirth Research OBJECTIVE: This review aimed to identify guidelines with recommendations applicable to the antenatal management of dichorionic diamniotic twin pregnancies within high-income countries, appraise their methodological quality, and discuss the similarities and variability across guidelines. METHOD: A systematic literature review of electronic databases was performed. Manual searches of guideline repositories and websites of professional organisations were performed to identify additional guidelines. The protocol for this systematic review was registered on PROSPERO (CRD42021248586, 25 June 2021). AGREE II and AGREE-REX tools were applied to assess the quality of eligible guidelines. A narrative and thematic synthesis described and compared the guidelines and their recommendations. RESULTS: Twenty-four guidelines were included, from which 483 recommendations were identified across 4 international organisations and 12 countries. Guidelines addressed eight themes and recommendations were classified accordingly: chorionicity and dating (103 recommendations), fetal growth (105 recommendations), termination of pregnancy (12 recommendations), fetal death (13 recommendations), fetal anomalies (65 recommendations), antenatal care (65 recommendations), preterm labour (56 recommendations) and birth (54 recommendations). Guidelines showed significant variability in recommendations, with conflicting recommendations regarding non-invasive preterm testing, definitions surrounding selective fetal growth restriction, screening for preterm labour and the timing of birth. Guidelines lacked a focus on standard antenatal management of DCDA twins, management of discordant fetal anomaly and single fetal demise. CONCLUSIONS: Specific guidance for dichorionic diamniotic twins is overall indistinct and access to guidance regarding the antenatal management of these pregnancies is currently difficult. Management of discordant fetal anomaly or single fetal demise needs greater consideration. SUPPLEMENTARY INFORMATION: The online version contains supplementary material available at 10.1186/s12884-023-05652-z. BioMed Central 2023-05-13 /pmc/articles/PMC10182673/ /pubmed/37179347 http://dx.doi.org/10.1186/s12884-023-05652-z Text en © The Author(s) 2023 https://creativecommons.org/licenses/by/4.0/Open AccessThis article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons licence, and indicate if changes were made. The images or other third party material in this article are included in the article’s Creative Commons licence, unless indicated otherwise in a credit line to the material. If material is not included in the article’s Creative Commons licence and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this licence, visit http://creativecommons.org/licenses/by/4.0/ (https://creativecommons.org/licenses/by/4.0/) . The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/ (https://creativecommons.org/publicdomain/zero/1.0/) ) applies to the data made available in this article, unless otherwise stated in a credit line to the data. |
spellingShingle | Research O’Connor, Caroline O’Connor, Emily Leitao, Sara Barrett, Shauna O’Donoghue, Keelin Clinical practice guidelines for the antenatal management of dichorionic diamniotic twin pregnancies: a systematic review |
title | Clinical practice guidelines for the antenatal management of dichorionic diamniotic twin pregnancies: a systematic review |
title_full | Clinical practice guidelines for the antenatal management of dichorionic diamniotic twin pregnancies: a systematic review |
title_fullStr | Clinical practice guidelines for the antenatal management of dichorionic diamniotic twin pregnancies: a systematic review |
title_full_unstemmed | Clinical practice guidelines for the antenatal management of dichorionic diamniotic twin pregnancies: a systematic review |
title_short | Clinical practice guidelines for the antenatal management of dichorionic diamniotic twin pregnancies: a systematic review |
title_sort | clinical practice guidelines for the antenatal management of dichorionic diamniotic twin pregnancies: a systematic review |
topic | Research |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10182673/ https://www.ncbi.nlm.nih.gov/pubmed/37179347 http://dx.doi.org/10.1186/s12884-023-05652-z |
work_keys_str_mv | AT oconnorcaroline clinicalpracticeguidelinesfortheantenatalmanagementofdichorionicdiamniotictwinpregnanciesasystematicreview AT oconnoremily clinicalpracticeguidelinesfortheantenatalmanagementofdichorionicdiamniotictwinpregnanciesasystematicreview AT leitaosara clinicalpracticeguidelinesfortheantenatalmanagementofdichorionicdiamniotictwinpregnanciesasystematicreview AT barrettshauna clinicalpracticeguidelinesfortheantenatalmanagementofdichorionicdiamniotictwinpregnanciesasystematicreview AT odonoghuekeelin clinicalpracticeguidelinesfortheantenatalmanagementofdichorionicdiamniotictwinpregnanciesasystematicreview |