Cargando…
Barriers and facilitators of HPV vaccination in sub-saharan Africa: a systematic review
BACKGROUND: Human Papilloma Virus (HPV) is the most common sexually transmitted infection worldwide. Globally, both men and women have a 50% risk of being infected at least once in their life. HPV prevalence is among the highest in sub-Saharan Africa (SSA), at an average of 24%. HPV causes different...
Autores principales: | , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
BioMed Central
2023
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10214362/ https://www.ncbi.nlm.nih.gov/pubmed/37237329 http://dx.doi.org/10.1186/s12889-023-15842-1 |
_version_ | 1785047825556439040 |
---|---|
author | Kutz, Jean-Marc Rausche, Pia Gheit, Tarik Puradiredja, Dewi Ismajani Fusco, Daniela |
author_facet | Kutz, Jean-Marc Rausche, Pia Gheit, Tarik Puradiredja, Dewi Ismajani Fusco, Daniela |
author_sort | Kutz, Jean-Marc |
collection | PubMed |
description | BACKGROUND: Human Papilloma Virus (HPV) is the most common sexually transmitted infection worldwide. Globally, both men and women have a 50% risk of being infected at least once in their life. HPV prevalence is among the highest in sub-Saharan Africa (SSA), at an average of 24%. HPV causes different types of cancers, including cervical cancer (CC), which is the leading cause of cancer deaths among women in SSA. HPV-vaccination has been proven to be effective in reducing HPV induced cancers. SSA countries are delayed in reaching the WHO’s target of fully vaccinating 90% of girls within the age of 15 by 2030. Our systematic review aims to identify barriers and facilitators of HPV-vaccination in SSA to inform national implementation strategies in the region. METHODS: This is a mixed method systematic review based on the PRISMA statement and The Joanna Briggs Institute Reviewers’ Manual. Search strategies were adapted to each selected database: PubMed/MEDLINE, Livivo, Google Scholar, Science Direct, and African Journals Online for papers published in English, Italian, German, French and Spanish between 1 December 2011 and 31 December 2021. Zotero and Rayyan were the software used for data management. The appraisal was conducted by three independent reviewers. RESULTS: A total of 20 articles were selected for appraisal from an initial 536 articles. Barriers included: limited health system capacities, socio-economic status, stigma, fear and costs of vaccines, negative experience with vaccinations, COVID-19 pandemic, lack of correct information, health education (HE) and consent. Additionally, we found that boys are scarcely considered for HPV-vaccination by parents and stakeholders. Facilitators included: information and knowledge, policy implementation, positive experience with vaccinations, HE, stakeholders’ engagement, women’s empowerment, community engagement, seasonality, and target-oriented vaccination campaigns. CONCLUSIONS: This review synthesizes barriers and facilitators of HPV-vaccinations in SSA. Addressing these can contribute to the implementation of more effective HPV immunization programs targeted at eliminating CC in line with the WHO 90/70/90 strategy. REGISTRATION AND FUNDING: Protocol ID: CRD42022338609 registered in the International Prospective Register of Systematic Reviews (PROSPERO). Partial funds: German Centre for Infection research (DZIF) project NAMASTE: 8,008,803,819. SUPPLEMENTARY INFORMATION: The online version contains supplementary material available at 10.1186/s12889-023-15842-1. |
format | Online Article Text |
id | pubmed-10214362 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2023 |
publisher | BioMed Central |
record_format | MEDLINE/PubMed |
spelling | pubmed-102143622023-05-28 Barriers and facilitators of HPV vaccination in sub-saharan Africa: a systematic review Kutz, Jean-Marc Rausche, Pia Gheit, Tarik Puradiredja, Dewi Ismajani Fusco, Daniela BMC Public Health Research BACKGROUND: Human Papilloma Virus (HPV) is the most common sexually transmitted infection worldwide. Globally, both men and women have a 50% risk of being infected at least once in their life. HPV prevalence is among the highest in sub-Saharan Africa (SSA), at an average of 24%. HPV causes different types of cancers, including cervical cancer (CC), which is the leading cause of cancer deaths among women in SSA. HPV-vaccination has been proven to be effective in reducing HPV induced cancers. SSA countries are delayed in reaching the WHO’s target of fully vaccinating 90% of girls within the age of 15 by 2030. Our systematic review aims to identify barriers and facilitators of HPV-vaccination in SSA to inform national implementation strategies in the region. METHODS: This is a mixed method systematic review based on the PRISMA statement and The Joanna Briggs Institute Reviewers’ Manual. Search strategies were adapted to each selected database: PubMed/MEDLINE, Livivo, Google Scholar, Science Direct, and African Journals Online for papers published in English, Italian, German, French and Spanish between 1 December 2011 and 31 December 2021. Zotero and Rayyan were the software used for data management. The appraisal was conducted by three independent reviewers. RESULTS: A total of 20 articles were selected for appraisal from an initial 536 articles. Barriers included: limited health system capacities, socio-economic status, stigma, fear and costs of vaccines, negative experience with vaccinations, COVID-19 pandemic, lack of correct information, health education (HE) and consent. Additionally, we found that boys are scarcely considered for HPV-vaccination by parents and stakeholders. Facilitators included: information and knowledge, policy implementation, positive experience with vaccinations, HE, stakeholders’ engagement, women’s empowerment, community engagement, seasonality, and target-oriented vaccination campaigns. CONCLUSIONS: This review synthesizes barriers and facilitators of HPV-vaccinations in SSA. Addressing these can contribute to the implementation of more effective HPV immunization programs targeted at eliminating CC in line with the WHO 90/70/90 strategy. REGISTRATION AND FUNDING: Protocol ID: CRD42022338609 registered in the International Prospective Register of Systematic Reviews (PROSPERO). Partial funds: German Centre for Infection research (DZIF) project NAMASTE: 8,008,803,819. SUPPLEMENTARY INFORMATION: The online version contains supplementary material available at 10.1186/s12889-023-15842-1. BioMed Central 2023-05-26 /pmc/articles/PMC10214362/ /pubmed/37237329 http://dx.doi.org/10.1186/s12889-023-15842-1 Text en © The Author(s) 2023 https://creativecommons.org/licenses/by/4.0/Open AccessThis article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons licence, and indicate if changes were made. The images or other third party material in this article are included in the article’s Creative Commons licence, unless indicated otherwise in a credit line to the material. If material is not included in the article’s Creative Commons licence and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this licence, visit http://creativecommons.org/licenses/by/4.0/ (https://creativecommons.org/licenses/by/4.0/) . The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/ (https://creativecommons.org/publicdomain/zero/1.0/) ) applies to the data made available in this article, unless otherwise stated in a credit line to the data. |
spellingShingle | Research Kutz, Jean-Marc Rausche, Pia Gheit, Tarik Puradiredja, Dewi Ismajani Fusco, Daniela Barriers and facilitators of HPV vaccination in sub-saharan Africa: a systematic review |
title | Barriers and facilitators of HPV vaccination in sub-saharan Africa: a systematic review |
title_full | Barriers and facilitators of HPV vaccination in sub-saharan Africa: a systematic review |
title_fullStr | Barriers and facilitators of HPV vaccination in sub-saharan Africa: a systematic review |
title_full_unstemmed | Barriers and facilitators of HPV vaccination in sub-saharan Africa: a systematic review |
title_short | Barriers and facilitators of HPV vaccination in sub-saharan Africa: a systematic review |
title_sort | barriers and facilitators of hpv vaccination in sub-saharan africa: a systematic review |
topic | Research |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10214362/ https://www.ncbi.nlm.nih.gov/pubmed/37237329 http://dx.doi.org/10.1186/s12889-023-15842-1 |
work_keys_str_mv | AT kutzjeanmarc barriersandfacilitatorsofhpvvaccinationinsubsaharanafricaasystematicreview AT rauschepia barriersandfacilitatorsofhpvvaccinationinsubsaharanafricaasystematicreview AT gheittarik barriersandfacilitatorsofhpvvaccinationinsubsaharanafricaasystematicreview AT puradiredjadewiismajani barriersandfacilitatorsofhpvvaccinationinsubsaharanafricaasystematicreview AT fuscodaniela barriersandfacilitatorsofhpvvaccinationinsubsaharanafricaasystematicreview |