Cargando…
Neoadjuvant Gastric Cancer Treatment and Associated Nutritional Critical Domains for the Optimization of Care Pathways: A Systematic Review
(1) Background: Gastric cancer patients are known to be at a high risk of malnutrition, sarcopenia, and cachexia, and the latter impairs the patient’s nutritional status during their clinical course and also treatment response. A clearer identification of nutrition-related critical points during neo...
Autores principales: | , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
MDPI
2023
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10223831/ https://www.ncbi.nlm.nih.gov/pubmed/37242125 http://dx.doi.org/10.3390/nu15102241 |
_version_ | 1785050035461816320 |
---|---|
author | Correia, Marta Moreira, Ines Cabral, Sonia Castro, Carolina Cruz, Andreia Magalhães, Bruno Santos, Lúcio Lara Irving, Susana Couto |
author_facet | Correia, Marta Moreira, Ines Cabral, Sonia Castro, Carolina Cruz, Andreia Magalhães, Bruno Santos, Lúcio Lara Irving, Susana Couto |
author_sort | Correia, Marta |
collection | PubMed |
description | (1) Background: Gastric cancer patients are known to be at a high risk of malnutrition, sarcopenia, and cachexia, and the latter impairs the patient’s nutritional status during their clinical course and also treatment response. A clearer identification of nutrition-related critical points during neoadjuvant treatment for gastric cancer is relevant to managing patient care and predicting clinical outcomes. The aim of this systematic review was to identify and describe nutrition-related critical domains associated with clinical outcomes. (2) Methods: We performed a systematic review (PROSPERO ID:CRD42021266760); (3) Results: This review included 14 studies compiled into three critical domains: patient-related, clinical-related (disease and treatment), and healthcare-related. Body composition changes during neoadjuvant chemotherapy (NAC) accounted for the early termination of chemotherapy and reduced overall survival. Sarcopenia was confirmed to have an independent prognostic value. The role of nutritional interventions during NAC has not been fully explored. (4) Conclusions: Understanding critical domain exposures affecting nutritional status will enable better clinical approaches to optimize care plans. It may also provide an opportunity for the mitigation of poor nutritional status and sarcopenia and their deleterious clinical consequences. |
format | Online Article Text |
id | pubmed-10223831 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2023 |
publisher | MDPI |
record_format | MEDLINE/PubMed |
spelling | pubmed-102238312023-05-28 Neoadjuvant Gastric Cancer Treatment and Associated Nutritional Critical Domains for the Optimization of Care Pathways: A Systematic Review Correia, Marta Moreira, Ines Cabral, Sonia Castro, Carolina Cruz, Andreia Magalhães, Bruno Santos, Lúcio Lara Irving, Susana Couto Nutrients Systematic Review (1) Background: Gastric cancer patients are known to be at a high risk of malnutrition, sarcopenia, and cachexia, and the latter impairs the patient’s nutritional status during their clinical course and also treatment response. A clearer identification of nutrition-related critical points during neoadjuvant treatment for gastric cancer is relevant to managing patient care and predicting clinical outcomes. The aim of this systematic review was to identify and describe nutrition-related critical domains associated with clinical outcomes. (2) Methods: We performed a systematic review (PROSPERO ID:CRD42021266760); (3) Results: This review included 14 studies compiled into three critical domains: patient-related, clinical-related (disease and treatment), and healthcare-related. Body composition changes during neoadjuvant chemotherapy (NAC) accounted for the early termination of chemotherapy and reduced overall survival. Sarcopenia was confirmed to have an independent prognostic value. The role of nutritional interventions during NAC has not been fully explored. (4) Conclusions: Understanding critical domain exposures affecting nutritional status will enable better clinical approaches to optimize care plans. It may also provide an opportunity for the mitigation of poor nutritional status and sarcopenia and their deleterious clinical consequences. MDPI 2023-05-09 /pmc/articles/PMC10223831/ /pubmed/37242125 http://dx.doi.org/10.3390/nu15102241 Text en © 2023 by the authors. https://creativecommons.org/licenses/by/4.0/Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (https://creativecommons.org/licenses/by/4.0/). |
spellingShingle | Systematic Review Correia, Marta Moreira, Ines Cabral, Sonia Castro, Carolina Cruz, Andreia Magalhães, Bruno Santos, Lúcio Lara Irving, Susana Couto Neoadjuvant Gastric Cancer Treatment and Associated Nutritional Critical Domains for the Optimization of Care Pathways: A Systematic Review |
title | Neoadjuvant Gastric Cancer Treatment and Associated Nutritional Critical Domains for the Optimization of Care Pathways: A Systematic Review |
title_full | Neoadjuvant Gastric Cancer Treatment and Associated Nutritional Critical Domains for the Optimization of Care Pathways: A Systematic Review |
title_fullStr | Neoadjuvant Gastric Cancer Treatment and Associated Nutritional Critical Domains for the Optimization of Care Pathways: A Systematic Review |
title_full_unstemmed | Neoadjuvant Gastric Cancer Treatment and Associated Nutritional Critical Domains for the Optimization of Care Pathways: A Systematic Review |
title_short | Neoadjuvant Gastric Cancer Treatment and Associated Nutritional Critical Domains for the Optimization of Care Pathways: A Systematic Review |
title_sort | neoadjuvant gastric cancer treatment and associated nutritional critical domains for the optimization of care pathways: a systematic review |
topic | Systematic Review |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10223831/ https://www.ncbi.nlm.nih.gov/pubmed/37242125 http://dx.doi.org/10.3390/nu15102241 |
work_keys_str_mv | AT correiamarta neoadjuvantgastriccancertreatmentandassociatednutritionalcriticaldomainsfortheoptimizationofcarepathwaysasystematicreview AT moreiraines neoadjuvantgastriccancertreatmentandassociatednutritionalcriticaldomainsfortheoptimizationofcarepathwaysasystematicreview AT cabralsonia neoadjuvantgastriccancertreatmentandassociatednutritionalcriticaldomainsfortheoptimizationofcarepathwaysasystematicreview AT castrocarolina neoadjuvantgastriccancertreatmentandassociatednutritionalcriticaldomainsfortheoptimizationofcarepathwaysasystematicreview AT cruzandreia neoadjuvantgastriccancertreatmentandassociatednutritionalcriticaldomainsfortheoptimizationofcarepathwaysasystematicreview AT magalhaesbruno neoadjuvantgastriccancertreatmentandassociatednutritionalcriticaldomainsfortheoptimizationofcarepathwaysasystematicreview AT santosluciolara neoadjuvantgastriccancertreatmentandassociatednutritionalcriticaldomainsfortheoptimizationofcarepathwaysasystematicreview AT irvingsusanacouto neoadjuvantgastriccancertreatmentandassociatednutritionalcriticaldomainsfortheoptimizationofcarepathwaysasystematicreview |