Cargando…

Neoadjuvant Gastric Cancer Treatment and Associated Nutritional Critical Domains for the Optimization of Care Pathways: A Systematic Review

(1) Background: Gastric cancer patients are known to be at a high risk of malnutrition, sarcopenia, and cachexia, and the latter impairs the patient’s nutritional status during their clinical course and also treatment response. A clearer identification of nutrition-related critical points during neo...

Descripción completa

Detalles Bibliográficos
Autores principales: Correia, Marta, Moreira, Ines, Cabral, Sonia, Castro, Carolina, Cruz, Andreia, Magalhães, Bruno, Santos, Lúcio Lara, Irving, Susana Couto
Formato: Online Artículo Texto
Lenguaje:English
Publicado: MDPI 2023
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10223831/
https://www.ncbi.nlm.nih.gov/pubmed/37242125
http://dx.doi.org/10.3390/nu15102241
_version_ 1785050035461816320
author Correia, Marta
Moreira, Ines
Cabral, Sonia
Castro, Carolina
Cruz, Andreia
Magalhães, Bruno
Santos, Lúcio Lara
Irving, Susana Couto
author_facet Correia, Marta
Moreira, Ines
Cabral, Sonia
Castro, Carolina
Cruz, Andreia
Magalhães, Bruno
Santos, Lúcio Lara
Irving, Susana Couto
author_sort Correia, Marta
collection PubMed
description (1) Background: Gastric cancer patients are known to be at a high risk of malnutrition, sarcopenia, and cachexia, and the latter impairs the patient’s nutritional status during their clinical course and also treatment response. A clearer identification of nutrition-related critical points during neoadjuvant treatment for gastric cancer is relevant to managing patient care and predicting clinical outcomes. The aim of this systematic review was to identify and describe nutrition-related critical domains associated with clinical outcomes. (2) Methods: We performed a systematic review (PROSPERO ID:CRD42021266760); (3) Results: This review included 14 studies compiled into three critical domains: patient-related, clinical-related (disease and treatment), and healthcare-related. Body composition changes during neoadjuvant chemotherapy (NAC) accounted for the early termination of chemotherapy and reduced overall survival. Sarcopenia was confirmed to have an independent prognostic value. The role of nutritional interventions during NAC has not been fully explored. (4) Conclusions: Understanding critical domain exposures affecting nutritional status will enable better clinical approaches to optimize care plans. It may also provide an opportunity for the mitigation of poor nutritional status and sarcopenia and their deleterious clinical consequences.
format Online
Article
Text
id pubmed-10223831
institution National Center for Biotechnology Information
language English
publishDate 2023
publisher MDPI
record_format MEDLINE/PubMed
spelling pubmed-102238312023-05-28 Neoadjuvant Gastric Cancer Treatment and Associated Nutritional Critical Domains for the Optimization of Care Pathways: A Systematic Review Correia, Marta Moreira, Ines Cabral, Sonia Castro, Carolina Cruz, Andreia Magalhães, Bruno Santos, Lúcio Lara Irving, Susana Couto Nutrients Systematic Review (1) Background: Gastric cancer patients are known to be at a high risk of malnutrition, sarcopenia, and cachexia, and the latter impairs the patient’s nutritional status during their clinical course and also treatment response. A clearer identification of nutrition-related critical points during neoadjuvant treatment for gastric cancer is relevant to managing patient care and predicting clinical outcomes. The aim of this systematic review was to identify and describe nutrition-related critical domains associated with clinical outcomes. (2) Methods: We performed a systematic review (PROSPERO ID:CRD42021266760); (3) Results: This review included 14 studies compiled into three critical domains: patient-related, clinical-related (disease and treatment), and healthcare-related. Body composition changes during neoadjuvant chemotherapy (NAC) accounted for the early termination of chemotherapy and reduced overall survival. Sarcopenia was confirmed to have an independent prognostic value. The role of nutritional interventions during NAC has not been fully explored. (4) Conclusions: Understanding critical domain exposures affecting nutritional status will enable better clinical approaches to optimize care plans. It may also provide an opportunity for the mitigation of poor nutritional status and sarcopenia and their deleterious clinical consequences. MDPI 2023-05-09 /pmc/articles/PMC10223831/ /pubmed/37242125 http://dx.doi.org/10.3390/nu15102241 Text en © 2023 by the authors. https://creativecommons.org/licenses/by/4.0/Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (https://creativecommons.org/licenses/by/4.0/).
spellingShingle Systematic Review
Correia, Marta
Moreira, Ines
Cabral, Sonia
Castro, Carolina
Cruz, Andreia
Magalhães, Bruno
Santos, Lúcio Lara
Irving, Susana Couto
Neoadjuvant Gastric Cancer Treatment and Associated Nutritional Critical Domains for the Optimization of Care Pathways: A Systematic Review
title Neoadjuvant Gastric Cancer Treatment and Associated Nutritional Critical Domains for the Optimization of Care Pathways: A Systematic Review
title_full Neoadjuvant Gastric Cancer Treatment and Associated Nutritional Critical Domains for the Optimization of Care Pathways: A Systematic Review
title_fullStr Neoadjuvant Gastric Cancer Treatment and Associated Nutritional Critical Domains for the Optimization of Care Pathways: A Systematic Review
title_full_unstemmed Neoadjuvant Gastric Cancer Treatment and Associated Nutritional Critical Domains for the Optimization of Care Pathways: A Systematic Review
title_short Neoadjuvant Gastric Cancer Treatment and Associated Nutritional Critical Domains for the Optimization of Care Pathways: A Systematic Review
title_sort neoadjuvant gastric cancer treatment and associated nutritional critical domains for the optimization of care pathways: a systematic review
topic Systematic Review
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10223831/
https://www.ncbi.nlm.nih.gov/pubmed/37242125
http://dx.doi.org/10.3390/nu15102241
work_keys_str_mv AT correiamarta neoadjuvantgastriccancertreatmentandassociatednutritionalcriticaldomainsfortheoptimizationofcarepathwaysasystematicreview
AT moreiraines neoadjuvantgastriccancertreatmentandassociatednutritionalcriticaldomainsfortheoptimizationofcarepathwaysasystematicreview
AT cabralsonia neoadjuvantgastriccancertreatmentandassociatednutritionalcriticaldomainsfortheoptimizationofcarepathwaysasystematicreview
AT castrocarolina neoadjuvantgastriccancertreatmentandassociatednutritionalcriticaldomainsfortheoptimizationofcarepathwaysasystematicreview
AT cruzandreia neoadjuvantgastriccancertreatmentandassociatednutritionalcriticaldomainsfortheoptimizationofcarepathwaysasystematicreview
AT magalhaesbruno neoadjuvantgastriccancertreatmentandassociatednutritionalcriticaldomainsfortheoptimizationofcarepathwaysasystematicreview
AT santosluciolara neoadjuvantgastriccancertreatmentandassociatednutritionalcriticaldomainsfortheoptimizationofcarepathwaysasystematicreview
AT irvingsusanacouto neoadjuvantgastriccancertreatmentandassociatednutritionalcriticaldomainsfortheoptimizationofcarepathwaysasystematicreview