Cargando…

Ras family signaling pathway in immunopathogenesis of inflammatory rheumatic diseases

The Ras (rat sarcoma virus) is a GTP-binding protein that is considered one of the important members of the Ras-GTPase superfamily. The Ras involves several pathways in the cell that include proliferation, migration, survival, differentiation, and fibrosis. Abnormalities in the expression level and...

Descripción completa

Detalles Bibliográficos
Autores principales: Sadeghi Shaker, Mina, Rokni, Mohsen, Mahmoudi, Mahdi, Farhadi, Elham
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Frontiers Media S.A. 2023
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10225558/
https://www.ncbi.nlm.nih.gov/pubmed/37256120
http://dx.doi.org/10.3389/fimmu.2023.1151246
_version_ 1785050399608143872
author Sadeghi Shaker, Mina
Rokni, Mohsen
Mahmoudi, Mahdi
Farhadi, Elham
author_facet Sadeghi Shaker, Mina
Rokni, Mohsen
Mahmoudi, Mahdi
Farhadi, Elham
author_sort Sadeghi Shaker, Mina
collection PubMed
description The Ras (rat sarcoma virus) is a GTP-binding protein that is considered one of the important members of the Ras-GTPase superfamily. The Ras involves several pathways in the cell that include proliferation, migration, survival, differentiation, and fibrosis. Abnormalities in the expression level and activation of the Ras family signaling pathway and its downstream kinases such as Raf/MEK/ERK1-2 contribute to the pathogenic mechanisms of rheumatic diseases including immune system dysregulation, inflammation, and fibrosis in systemic sclerosis (SSc); destruction and inflammation of synovial tissue in rheumatoid arthritis (RA); and autoantibody production and immune complexes formation in systemic lupus erythematosus (SLE); and enhance osteoblast differentiation and ossification during skeletal formation in ankylosing spondylitis (AS). In this review, the basic biology, signaling of Ras, and abnormalities in this pathway in rheumatic diseases including SSc, RA, AS, and SLE will be discussed.
format Online
Article
Text
id pubmed-10225558
institution National Center for Biotechnology Information
language English
publishDate 2023
publisher Frontiers Media S.A.
record_format MEDLINE/PubMed
spelling pubmed-102255582023-05-30 Ras family signaling pathway in immunopathogenesis of inflammatory rheumatic diseases Sadeghi Shaker, Mina Rokni, Mohsen Mahmoudi, Mahdi Farhadi, Elham Front Immunol Immunology The Ras (rat sarcoma virus) is a GTP-binding protein that is considered one of the important members of the Ras-GTPase superfamily. The Ras involves several pathways in the cell that include proliferation, migration, survival, differentiation, and fibrosis. Abnormalities in the expression level and activation of the Ras family signaling pathway and its downstream kinases such as Raf/MEK/ERK1-2 contribute to the pathogenic mechanisms of rheumatic diseases including immune system dysregulation, inflammation, and fibrosis in systemic sclerosis (SSc); destruction and inflammation of synovial tissue in rheumatoid arthritis (RA); and autoantibody production and immune complexes formation in systemic lupus erythematosus (SLE); and enhance osteoblast differentiation and ossification during skeletal formation in ankylosing spondylitis (AS). In this review, the basic biology, signaling of Ras, and abnormalities in this pathway in rheumatic diseases including SSc, RA, AS, and SLE will be discussed. Frontiers Media S.A. 2023-05-15 /pmc/articles/PMC10225558/ /pubmed/37256120 http://dx.doi.org/10.3389/fimmu.2023.1151246 Text en Copyright © 2023 Sadeghi Shaker, Rokni, Mahmoudi and Farhadi https://creativecommons.org/licenses/by/4.0/This is an open-access article distributed under the terms of the Creative Commons Attribution License (CC BY). The use, distribution or reproduction in other forums is permitted, provided the original author(s) and the copyright owner(s) are credited and that the original publication in this journal is cited, in accordance with accepted academic practice. No use, distribution or reproduction is permitted which does not comply with these terms.
spellingShingle Immunology
Sadeghi Shaker, Mina
Rokni, Mohsen
Mahmoudi, Mahdi
Farhadi, Elham
Ras family signaling pathway in immunopathogenesis of inflammatory rheumatic diseases
title Ras family signaling pathway in immunopathogenesis of inflammatory rheumatic diseases
title_full Ras family signaling pathway in immunopathogenesis of inflammatory rheumatic diseases
title_fullStr Ras family signaling pathway in immunopathogenesis of inflammatory rheumatic diseases
title_full_unstemmed Ras family signaling pathway in immunopathogenesis of inflammatory rheumatic diseases
title_short Ras family signaling pathway in immunopathogenesis of inflammatory rheumatic diseases
title_sort ras family signaling pathway in immunopathogenesis of inflammatory rheumatic diseases
topic Immunology
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10225558/
https://www.ncbi.nlm.nih.gov/pubmed/37256120
http://dx.doi.org/10.3389/fimmu.2023.1151246
work_keys_str_mv AT sadeghishakermina rasfamilysignalingpathwayinimmunopathogenesisofinflammatoryrheumaticdiseases
AT roknimohsen rasfamilysignalingpathwayinimmunopathogenesisofinflammatoryrheumaticdiseases
AT mahmoudimahdi rasfamilysignalingpathwayinimmunopathogenesisofinflammatoryrheumaticdiseases
AT farhadielham rasfamilysignalingpathwayinimmunopathogenesisofinflammatoryrheumaticdiseases