Cargando…
Ras family signaling pathway in immunopathogenesis of inflammatory rheumatic diseases
The Ras (rat sarcoma virus) is a GTP-binding protein that is considered one of the important members of the Ras-GTPase superfamily. The Ras involves several pathways in the cell that include proliferation, migration, survival, differentiation, and fibrosis. Abnormalities in the expression level and...
Autores principales: | , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Frontiers Media S.A.
2023
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10225558/ https://www.ncbi.nlm.nih.gov/pubmed/37256120 http://dx.doi.org/10.3389/fimmu.2023.1151246 |
_version_ | 1785050399608143872 |
---|---|
author | Sadeghi Shaker, Mina Rokni, Mohsen Mahmoudi, Mahdi Farhadi, Elham |
author_facet | Sadeghi Shaker, Mina Rokni, Mohsen Mahmoudi, Mahdi Farhadi, Elham |
author_sort | Sadeghi Shaker, Mina |
collection | PubMed |
description | The Ras (rat sarcoma virus) is a GTP-binding protein that is considered one of the important members of the Ras-GTPase superfamily. The Ras involves several pathways in the cell that include proliferation, migration, survival, differentiation, and fibrosis. Abnormalities in the expression level and activation of the Ras family signaling pathway and its downstream kinases such as Raf/MEK/ERK1-2 contribute to the pathogenic mechanisms of rheumatic diseases including immune system dysregulation, inflammation, and fibrosis in systemic sclerosis (SSc); destruction and inflammation of synovial tissue in rheumatoid arthritis (RA); and autoantibody production and immune complexes formation in systemic lupus erythematosus (SLE); and enhance osteoblast differentiation and ossification during skeletal formation in ankylosing spondylitis (AS). In this review, the basic biology, signaling of Ras, and abnormalities in this pathway in rheumatic diseases including SSc, RA, AS, and SLE will be discussed. |
format | Online Article Text |
id | pubmed-10225558 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2023 |
publisher | Frontiers Media S.A. |
record_format | MEDLINE/PubMed |
spelling | pubmed-102255582023-05-30 Ras family signaling pathway in immunopathogenesis of inflammatory rheumatic diseases Sadeghi Shaker, Mina Rokni, Mohsen Mahmoudi, Mahdi Farhadi, Elham Front Immunol Immunology The Ras (rat sarcoma virus) is a GTP-binding protein that is considered one of the important members of the Ras-GTPase superfamily. The Ras involves several pathways in the cell that include proliferation, migration, survival, differentiation, and fibrosis. Abnormalities in the expression level and activation of the Ras family signaling pathway and its downstream kinases such as Raf/MEK/ERK1-2 contribute to the pathogenic mechanisms of rheumatic diseases including immune system dysregulation, inflammation, and fibrosis in systemic sclerosis (SSc); destruction and inflammation of synovial tissue in rheumatoid arthritis (RA); and autoantibody production and immune complexes formation in systemic lupus erythematosus (SLE); and enhance osteoblast differentiation and ossification during skeletal formation in ankylosing spondylitis (AS). In this review, the basic biology, signaling of Ras, and abnormalities in this pathway in rheumatic diseases including SSc, RA, AS, and SLE will be discussed. Frontiers Media S.A. 2023-05-15 /pmc/articles/PMC10225558/ /pubmed/37256120 http://dx.doi.org/10.3389/fimmu.2023.1151246 Text en Copyright © 2023 Sadeghi Shaker, Rokni, Mahmoudi and Farhadi https://creativecommons.org/licenses/by/4.0/This is an open-access article distributed under the terms of the Creative Commons Attribution License (CC BY). The use, distribution or reproduction in other forums is permitted, provided the original author(s) and the copyright owner(s) are credited and that the original publication in this journal is cited, in accordance with accepted academic practice. No use, distribution or reproduction is permitted which does not comply with these terms. |
spellingShingle | Immunology Sadeghi Shaker, Mina Rokni, Mohsen Mahmoudi, Mahdi Farhadi, Elham Ras family signaling pathway in immunopathogenesis of inflammatory rheumatic diseases |
title | Ras family signaling pathway in immunopathogenesis of inflammatory rheumatic diseases |
title_full | Ras family signaling pathway in immunopathogenesis of inflammatory rheumatic diseases |
title_fullStr | Ras family signaling pathway in immunopathogenesis of inflammatory rheumatic diseases |
title_full_unstemmed | Ras family signaling pathway in immunopathogenesis of inflammatory rheumatic diseases |
title_short | Ras family signaling pathway in immunopathogenesis of inflammatory rheumatic diseases |
title_sort | ras family signaling pathway in immunopathogenesis of inflammatory rheumatic diseases |
topic | Immunology |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10225558/ https://www.ncbi.nlm.nih.gov/pubmed/37256120 http://dx.doi.org/10.3389/fimmu.2023.1151246 |
work_keys_str_mv | AT sadeghishakermina rasfamilysignalingpathwayinimmunopathogenesisofinflammatoryrheumaticdiseases AT roknimohsen rasfamilysignalingpathwayinimmunopathogenesisofinflammatoryrheumaticdiseases AT mahmoudimahdi rasfamilysignalingpathwayinimmunopathogenesisofinflammatoryrheumaticdiseases AT farhadielham rasfamilysignalingpathwayinimmunopathogenesisofinflammatoryrheumaticdiseases |