Cargando…
A high-quality, long-read genome assembly of the whitelined sphinx moth (Lepidoptera: Sphingidae: Hyles lineata) shows highly conserved melanin synthesis pathway genes
The sphinx moth genus Hyles comprises 29 described species inhabiting all continents except Antarctica. The genus diverged relatively recently (40–25 MYA), arising in the Americas and rapidly establishing a cosmopolitan distribution. The whitelined sphinx moth, Hyles lineata, represents the oldest e...
Autores principales: | , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Oxford University Press
2023
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10234378/ https://www.ncbi.nlm.nih.gov/pubmed/37119801 http://dx.doi.org/10.1093/g3journal/jkad090 |
_version_ | 1785052479679889408 |
---|---|
author | Godfrey, R Keating Britton, Sarah E Mishra, Shova Goldberg, Jay K Kawahara, Akito Y |
author_facet | Godfrey, R Keating Britton, Sarah E Mishra, Shova Goldberg, Jay K Kawahara, Akito Y |
author_sort | Godfrey, R Keating |
collection | PubMed |
description | The sphinx moth genus Hyles comprises 29 described species inhabiting all continents except Antarctica. The genus diverged relatively recently (40–25 MYA), arising in the Americas and rapidly establishing a cosmopolitan distribution. The whitelined sphinx moth, Hyles lineata, represents the oldest extant lineage of this group and is one of the most widespread and abundant sphinx moths in North America. Hyles lineata exhibits the large body size and adept flight control characteristic of the sphinx moth family (Sphingidae), but it is unique in displaying extreme larval color variation and broad host plant use. These traits, in combination with its broad distribution and high relative abundance within its range, have made H. lineata a model organism for studying phenotypic plasticity, plant–herbivore interactions, physiological ecology, and flight control. Despite being one of the most well-studied sphinx moths, little data exist on genetic variation or regulation of gene expression. Here, we report a high-quality genome showing high contiguity (N50 of 14.2 Mb) and completeness (98.2% of Lepidoptera BUSCO genes), an important first characterization to facilitate such studies. We also annotate the core melanin synthesis pathway genes and confirm that they have high sequence conservation with other moths and are most similar to those of another, well-characterized sphinx moth, the tobacco hornworm (Manduca sexta). |
format | Online Article Text |
id | pubmed-10234378 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2023 |
publisher | Oxford University Press |
record_format | MEDLINE/PubMed |
spelling | pubmed-102343782023-06-02 A high-quality, long-read genome assembly of the whitelined sphinx moth (Lepidoptera: Sphingidae: Hyles lineata) shows highly conserved melanin synthesis pathway genes Godfrey, R Keating Britton, Sarah E Mishra, Shova Goldberg, Jay K Kawahara, Akito Y G3 (Bethesda) Genome Report The sphinx moth genus Hyles comprises 29 described species inhabiting all continents except Antarctica. The genus diverged relatively recently (40–25 MYA), arising in the Americas and rapidly establishing a cosmopolitan distribution. The whitelined sphinx moth, Hyles lineata, represents the oldest extant lineage of this group and is one of the most widespread and abundant sphinx moths in North America. Hyles lineata exhibits the large body size and adept flight control characteristic of the sphinx moth family (Sphingidae), but it is unique in displaying extreme larval color variation and broad host plant use. These traits, in combination with its broad distribution and high relative abundance within its range, have made H. lineata a model organism for studying phenotypic plasticity, plant–herbivore interactions, physiological ecology, and flight control. Despite being one of the most well-studied sphinx moths, little data exist on genetic variation or regulation of gene expression. Here, we report a high-quality genome showing high contiguity (N50 of 14.2 Mb) and completeness (98.2% of Lepidoptera BUSCO genes), an important first characterization to facilitate such studies. We also annotate the core melanin synthesis pathway genes and confirm that they have high sequence conservation with other moths and are most similar to those of another, well-characterized sphinx moth, the tobacco hornworm (Manduca sexta). Oxford University Press 2023-04-29 /pmc/articles/PMC10234378/ /pubmed/37119801 http://dx.doi.org/10.1093/g3journal/jkad090 Text en © The Author(s) 2023. Published by Oxford University Press on behalf of The Genetics Society of America. https://creativecommons.org/licenses/by/4.0/This is an Open Access article distributed under the terms of the Creative Commons Attribution License (https://creativecommons.org/licenses/by/4.0/), which permits unrestricted reuse, distribution, and reproduction in any medium, provided the original work is properly cited. |
spellingShingle | Genome Report Godfrey, R Keating Britton, Sarah E Mishra, Shova Goldberg, Jay K Kawahara, Akito Y A high-quality, long-read genome assembly of the whitelined sphinx moth (Lepidoptera: Sphingidae: Hyles lineata) shows highly conserved melanin synthesis pathway genes |
title | A high-quality, long-read genome assembly of the whitelined sphinx moth (Lepidoptera: Sphingidae: Hyles lineata) shows highly conserved melanin synthesis pathway genes |
title_full | A high-quality, long-read genome assembly of the whitelined sphinx moth (Lepidoptera: Sphingidae: Hyles lineata) shows highly conserved melanin synthesis pathway genes |
title_fullStr | A high-quality, long-read genome assembly of the whitelined sphinx moth (Lepidoptera: Sphingidae: Hyles lineata) shows highly conserved melanin synthesis pathway genes |
title_full_unstemmed | A high-quality, long-read genome assembly of the whitelined sphinx moth (Lepidoptera: Sphingidae: Hyles lineata) shows highly conserved melanin synthesis pathway genes |
title_short | A high-quality, long-read genome assembly of the whitelined sphinx moth (Lepidoptera: Sphingidae: Hyles lineata) shows highly conserved melanin synthesis pathway genes |
title_sort | high-quality, long-read genome assembly of the whitelined sphinx moth (lepidoptera: sphingidae: hyles lineata) shows highly conserved melanin synthesis pathway genes |
topic | Genome Report |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10234378/ https://www.ncbi.nlm.nih.gov/pubmed/37119801 http://dx.doi.org/10.1093/g3journal/jkad090 |
work_keys_str_mv | AT godfreyrkeating ahighqualitylongreadgenomeassemblyofthewhitelinedsphinxmothlepidopterasphingidaehyleslineatashowshighlyconservedmelaninsynthesispathwaygenes AT brittonsarahe ahighqualitylongreadgenomeassemblyofthewhitelinedsphinxmothlepidopterasphingidaehyleslineatashowshighlyconservedmelaninsynthesispathwaygenes AT mishrashova ahighqualitylongreadgenomeassemblyofthewhitelinedsphinxmothlepidopterasphingidaehyleslineatashowshighlyconservedmelaninsynthesispathwaygenes AT goldbergjayk ahighqualitylongreadgenomeassemblyofthewhitelinedsphinxmothlepidopterasphingidaehyleslineatashowshighlyconservedmelaninsynthesispathwaygenes AT kawaharaakitoy ahighqualitylongreadgenomeassemblyofthewhitelinedsphinxmothlepidopterasphingidaehyleslineatashowshighlyconservedmelaninsynthesispathwaygenes AT godfreyrkeating highqualitylongreadgenomeassemblyofthewhitelinedsphinxmothlepidopterasphingidaehyleslineatashowshighlyconservedmelaninsynthesispathwaygenes AT brittonsarahe highqualitylongreadgenomeassemblyofthewhitelinedsphinxmothlepidopterasphingidaehyleslineatashowshighlyconservedmelaninsynthesispathwaygenes AT mishrashova highqualitylongreadgenomeassemblyofthewhitelinedsphinxmothlepidopterasphingidaehyleslineatashowshighlyconservedmelaninsynthesispathwaygenes AT goldbergjayk highqualitylongreadgenomeassemblyofthewhitelinedsphinxmothlepidopterasphingidaehyleslineatashowshighlyconservedmelaninsynthesispathwaygenes AT kawaharaakitoy highqualitylongreadgenomeassemblyofthewhitelinedsphinxmothlepidopterasphingidaehyleslineatashowshighlyconservedmelaninsynthesispathwaygenes |