Cargando…

A high-quality, long-read genome assembly of the whitelined sphinx moth (Lepidoptera: Sphingidae: Hyles lineata) shows highly conserved melanin synthesis pathway genes

The sphinx moth genus Hyles comprises 29 described species inhabiting all continents except Antarctica. The genus diverged relatively recently (40–25 MYA), arising in the Americas and rapidly establishing a cosmopolitan distribution. The whitelined sphinx moth, Hyles lineata, represents the oldest e...

Descripción completa

Detalles Bibliográficos
Autores principales: Godfrey, R Keating, Britton, Sarah E, Mishra, Shova, Goldberg, Jay K, Kawahara, Akito Y
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Oxford University Press 2023
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10234378/
https://www.ncbi.nlm.nih.gov/pubmed/37119801
http://dx.doi.org/10.1093/g3journal/jkad090
_version_ 1785052479679889408
author Godfrey, R Keating
Britton, Sarah E
Mishra, Shova
Goldberg, Jay K
Kawahara, Akito Y
author_facet Godfrey, R Keating
Britton, Sarah E
Mishra, Shova
Goldberg, Jay K
Kawahara, Akito Y
author_sort Godfrey, R Keating
collection PubMed
description The sphinx moth genus Hyles comprises 29 described species inhabiting all continents except Antarctica. The genus diverged relatively recently (40–25 MYA), arising in the Americas and rapidly establishing a cosmopolitan distribution. The whitelined sphinx moth, Hyles lineata, represents the oldest extant lineage of this group and is one of the most widespread and abundant sphinx moths in North America. Hyles lineata exhibits the large body size and adept flight control characteristic of the sphinx moth family (Sphingidae), but it is unique in displaying extreme larval color variation and broad host plant use. These traits, in combination with its broad distribution and high relative abundance within its range, have made H. lineata a model organism for studying phenotypic plasticity, plant–herbivore interactions, physiological ecology, and flight control. Despite being one of the most well-studied sphinx moths, little data exist on genetic variation or regulation of gene expression. Here, we report a high-quality genome showing high contiguity (N50 of 14.2 Mb) and completeness (98.2% of Lepidoptera BUSCO genes), an important first characterization to facilitate such studies. We also annotate the core melanin synthesis pathway genes and confirm that they have high sequence conservation with other moths and are most similar to those of another, well-characterized sphinx moth, the tobacco hornworm (Manduca sexta).
format Online
Article
Text
id pubmed-10234378
institution National Center for Biotechnology Information
language English
publishDate 2023
publisher Oxford University Press
record_format MEDLINE/PubMed
spelling pubmed-102343782023-06-02 A high-quality, long-read genome assembly of the whitelined sphinx moth (Lepidoptera: Sphingidae: Hyles lineata) shows highly conserved melanin synthesis pathway genes Godfrey, R Keating Britton, Sarah E Mishra, Shova Goldberg, Jay K Kawahara, Akito Y G3 (Bethesda) Genome Report The sphinx moth genus Hyles comprises 29 described species inhabiting all continents except Antarctica. The genus diverged relatively recently (40–25 MYA), arising in the Americas and rapidly establishing a cosmopolitan distribution. The whitelined sphinx moth, Hyles lineata, represents the oldest extant lineage of this group and is one of the most widespread and abundant sphinx moths in North America. Hyles lineata exhibits the large body size and adept flight control characteristic of the sphinx moth family (Sphingidae), but it is unique in displaying extreme larval color variation and broad host plant use. These traits, in combination with its broad distribution and high relative abundance within its range, have made H. lineata a model organism for studying phenotypic plasticity, plant–herbivore interactions, physiological ecology, and flight control. Despite being one of the most well-studied sphinx moths, little data exist on genetic variation or regulation of gene expression. Here, we report a high-quality genome showing high contiguity (N50 of 14.2 Mb) and completeness (98.2% of Lepidoptera BUSCO genes), an important first characterization to facilitate such studies. We also annotate the core melanin synthesis pathway genes and confirm that they have high sequence conservation with other moths and are most similar to those of another, well-characterized sphinx moth, the tobacco hornworm (Manduca sexta). Oxford University Press 2023-04-29 /pmc/articles/PMC10234378/ /pubmed/37119801 http://dx.doi.org/10.1093/g3journal/jkad090 Text en © The Author(s) 2023. Published by Oxford University Press on behalf of The Genetics Society of America. https://creativecommons.org/licenses/by/4.0/This is an Open Access article distributed under the terms of the Creative Commons Attribution License (https://creativecommons.org/licenses/by/4.0/), which permits unrestricted reuse, distribution, and reproduction in any medium, provided the original work is properly cited.
spellingShingle Genome Report
Godfrey, R Keating
Britton, Sarah E
Mishra, Shova
Goldberg, Jay K
Kawahara, Akito Y
A high-quality, long-read genome assembly of the whitelined sphinx moth (Lepidoptera: Sphingidae: Hyles lineata) shows highly conserved melanin synthesis pathway genes
title A high-quality, long-read genome assembly of the whitelined sphinx moth (Lepidoptera: Sphingidae: Hyles lineata) shows highly conserved melanin synthesis pathway genes
title_full A high-quality, long-read genome assembly of the whitelined sphinx moth (Lepidoptera: Sphingidae: Hyles lineata) shows highly conserved melanin synthesis pathway genes
title_fullStr A high-quality, long-read genome assembly of the whitelined sphinx moth (Lepidoptera: Sphingidae: Hyles lineata) shows highly conserved melanin synthesis pathway genes
title_full_unstemmed A high-quality, long-read genome assembly of the whitelined sphinx moth (Lepidoptera: Sphingidae: Hyles lineata) shows highly conserved melanin synthesis pathway genes
title_short A high-quality, long-read genome assembly of the whitelined sphinx moth (Lepidoptera: Sphingidae: Hyles lineata) shows highly conserved melanin synthesis pathway genes
title_sort high-quality, long-read genome assembly of the whitelined sphinx moth (lepidoptera: sphingidae: hyles lineata) shows highly conserved melanin synthesis pathway genes
topic Genome Report
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10234378/
https://www.ncbi.nlm.nih.gov/pubmed/37119801
http://dx.doi.org/10.1093/g3journal/jkad090
work_keys_str_mv AT godfreyrkeating ahighqualitylongreadgenomeassemblyofthewhitelinedsphinxmothlepidopterasphingidaehyleslineatashowshighlyconservedmelaninsynthesispathwaygenes
AT brittonsarahe ahighqualitylongreadgenomeassemblyofthewhitelinedsphinxmothlepidopterasphingidaehyleslineatashowshighlyconservedmelaninsynthesispathwaygenes
AT mishrashova ahighqualitylongreadgenomeassemblyofthewhitelinedsphinxmothlepidopterasphingidaehyleslineatashowshighlyconservedmelaninsynthesispathwaygenes
AT goldbergjayk ahighqualitylongreadgenomeassemblyofthewhitelinedsphinxmothlepidopterasphingidaehyleslineatashowshighlyconservedmelaninsynthesispathwaygenes
AT kawaharaakitoy ahighqualitylongreadgenomeassemblyofthewhitelinedsphinxmothlepidopterasphingidaehyleslineatashowshighlyconservedmelaninsynthesispathwaygenes
AT godfreyrkeating highqualitylongreadgenomeassemblyofthewhitelinedsphinxmothlepidopterasphingidaehyleslineatashowshighlyconservedmelaninsynthesispathwaygenes
AT brittonsarahe highqualitylongreadgenomeassemblyofthewhitelinedsphinxmothlepidopterasphingidaehyleslineatashowshighlyconservedmelaninsynthesispathwaygenes
AT mishrashova highqualitylongreadgenomeassemblyofthewhitelinedsphinxmothlepidopterasphingidaehyleslineatashowshighlyconservedmelaninsynthesispathwaygenes
AT goldbergjayk highqualitylongreadgenomeassemblyofthewhitelinedsphinxmothlepidopterasphingidaehyleslineatashowshighlyconservedmelaninsynthesispathwaygenes
AT kawaharaakitoy highqualitylongreadgenomeassemblyofthewhitelinedsphinxmothlepidopterasphingidaehyleslineatashowshighlyconservedmelaninsynthesispathwaygenes