Cargando…
Novel Compound Heterozygous Mutations in the SYNE1 Gene in a Taiwanese Family: A Case Report and Literature Review
Mutations in the synaptic nuclear envelope protein 1 (SYNE1) gene are associated with substantial clinical heterogeneity. Here, we report the first case of SYNE1 ataxia in Taiwan due to two novel truncating mutations. Our patient, a 53-year-old female, exhibited pure cerebellar ataxia with c.1922del...
Autores principales: | , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
The Korean Movement Disorder Society
2023
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10236026/ https://www.ncbi.nlm.nih.gov/pubmed/37096302 http://dx.doi.org/10.14802/jmd.22105 |
_version_ | 1785052834903883776 |
---|---|
author | Kuo, Chia-Yan Yu, Pei Shan Chao, Chih-Ying Wang, Chun-Chieh Fan, Wen-Lang Wu, Yih-Ru |
author_facet | Kuo, Chia-Yan Yu, Pei Shan Chao, Chih-Ying Wang, Chun-Chieh Fan, Wen-Lang Wu, Yih-Ru |
author_sort | Kuo, Chia-Yan |
collection | PubMed |
description | Mutations in the synaptic nuclear envelope protein 1 (SYNE1) gene are associated with substantial clinical heterogeneity. Here, we report the first case of SYNE1 ataxia in Taiwan due to two novel truncating mutations. Our patient, a 53-year-old female, exhibited pure cerebellar ataxia with c.1922del in exon 18 and c. C3883T mutations in exon 31. Previous studies have indicated that the prevalence of SYNE1 ataxia among East Asian populations is low. In this study, we identified 27 cases of SYNE1 ataxia from 22 families in East Asia. Of the 28 patients recruited in this study (including our patient), 10 exhibited pure cerebellar ataxia, and 18 exhibited ataxia plus syndromes. We could not find an exact correlation between genotypes and phenotypes. Additionally, we established a precise molecular diagnosis in our patient’s family and extended the findings on the ethnic, phenotypic, and genotypic diversity of the SYNE1 mutational spectrum. |
format | Online Article Text |
id | pubmed-10236026 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2023 |
publisher | The Korean Movement Disorder Society |
record_format | MEDLINE/PubMed |
spelling | pubmed-102360262023-06-03 Novel Compound Heterozygous Mutations in the SYNE1 Gene in a Taiwanese Family: A Case Report and Literature Review Kuo, Chia-Yan Yu, Pei Shan Chao, Chih-Ying Wang, Chun-Chieh Fan, Wen-Lang Wu, Yih-Ru J Mov Disord Case Report Mutations in the synaptic nuclear envelope protein 1 (SYNE1) gene are associated with substantial clinical heterogeneity. Here, we report the first case of SYNE1 ataxia in Taiwan due to two novel truncating mutations. Our patient, a 53-year-old female, exhibited pure cerebellar ataxia with c.1922del in exon 18 and c. C3883T mutations in exon 31. Previous studies have indicated that the prevalence of SYNE1 ataxia among East Asian populations is low. In this study, we identified 27 cases of SYNE1 ataxia from 22 families in East Asia. Of the 28 patients recruited in this study (including our patient), 10 exhibited pure cerebellar ataxia, and 18 exhibited ataxia plus syndromes. We could not find an exact correlation between genotypes and phenotypes. Additionally, we established a precise molecular diagnosis in our patient’s family and extended the findings on the ethnic, phenotypic, and genotypic diversity of the SYNE1 mutational spectrum. The Korean Movement Disorder Society 2023-05 2023-04-26 /pmc/articles/PMC10236026/ /pubmed/37096302 http://dx.doi.org/10.14802/jmd.22105 Text en Copyright © 2023 The Korean Movement Disorder Society https://creativecommons.org/licenses/by-nc/4.0/This is an Open Access article distributed under the terms of the Creative Commons Attribution Non-Commercial License (http://creativecommons.org/licenses/by-nc/4.0/ (https://creativecommons.org/licenses/by-nc/4.0/) ) which permits unrestricted non-commercial use, distribution, and reproduction in any medium, provided the original work is properly cited. |
spellingShingle | Case Report Kuo, Chia-Yan Yu, Pei Shan Chao, Chih-Ying Wang, Chun-Chieh Fan, Wen-Lang Wu, Yih-Ru Novel Compound Heterozygous Mutations in the SYNE1 Gene in a Taiwanese Family: A Case Report and Literature Review |
title | Novel Compound Heterozygous Mutations in the SYNE1 Gene in a Taiwanese Family: A Case Report and Literature Review |
title_full | Novel Compound Heterozygous Mutations in the SYNE1 Gene in a Taiwanese Family: A Case Report and Literature Review |
title_fullStr | Novel Compound Heterozygous Mutations in the SYNE1 Gene in a Taiwanese Family: A Case Report and Literature Review |
title_full_unstemmed | Novel Compound Heterozygous Mutations in the SYNE1 Gene in a Taiwanese Family: A Case Report and Literature Review |
title_short | Novel Compound Heterozygous Mutations in the SYNE1 Gene in a Taiwanese Family: A Case Report and Literature Review |
title_sort | novel compound heterozygous mutations in the syne1 gene in a taiwanese family: a case report and literature review |
topic | Case Report |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10236026/ https://www.ncbi.nlm.nih.gov/pubmed/37096302 http://dx.doi.org/10.14802/jmd.22105 |
work_keys_str_mv | AT kuochiayan novelcompoundheterozygousmutationsinthesyne1geneinataiwanesefamilyacasereportandliteraturereview AT yupeishan novelcompoundheterozygousmutationsinthesyne1geneinataiwanesefamilyacasereportandliteraturereview AT chaochihying novelcompoundheterozygousmutationsinthesyne1geneinataiwanesefamilyacasereportandliteraturereview AT wangchunchieh novelcompoundheterozygousmutationsinthesyne1geneinataiwanesefamilyacasereportandliteraturereview AT fanwenlang novelcompoundheterozygousmutationsinthesyne1geneinataiwanesefamilyacasereportandliteraturereview AT wuyihru novelcompoundheterozygousmutationsinthesyne1geneinataiwanesefamilyacasereportandliteraturereview |