Cargando…

Novel Compound Heterozygous Mutations in the SYNE1 Gene in a Taiwanese Family: A Case Report and Literature Review

Mutations in the synaptic nuclear envelope protein 1 (SYNE1) gene are associated with substantial clinical heterogeneity. Here, we report the first case of SYNE1 ataxia in Taiwan due to two novel truncating mutations. Our patient, a 53-year-old female, exhibited pure cerebellar ataxia with c.1922del...

Descripción completa

Detalles Bibliográficos
Autores principales: Kuo, Chia-Yan, Yu, Pei Shan, Chao, Chih-Ying, Wang, Chun-Chieh, Fan, Wen-Lang, Wu, Yih-Ru
Formato: Online Artículo Texto
Lenguaje:English
Publicado: The Korean Movement Disorder Society 2023
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10236026/
https://www.ncbi.nlm.nih.gov/pubmed/37096302
http://dx.doi.org/10.14802/jmd.22105
_version_ 1785052834903883776
author Kuo, Chia-Yan
Yu, Pei Shan
Chao, Chih-Ying
Wang, Chun-Chieh
Fan, Wen-Lang
Wu, Yih-Ru
author_facet Kuo, Chia-Yan
Yu, Pei Shan
Chao, Chih-Ying
Wang, Chun-Chieh
Fan, Wen-Lang
Wu, Yih-Ru
author_sort Kuo, Chia-Yan
collection PubMed
description Mutations in the synaptic nuclear envelope protein 1 (SYNE1) gene are associated with substantial clinical heterogeneity. Here, we report the first case of SYNE1 ataxia in Taiwan due to two novel truncating mutations. Our patient, a 53-year-old female, exhibited pure cerebellar ataxia with c.1922del in exon 18 and c. C3883T mutations in exon 31. Previous studies have indicated that the prevalence of SYNE1 ataxia among East Asian populations is low. In this study, we identified 27 cases of SYNE1 ataxia from 22 families in East Asia. Of the 28 patients recruited in this study (including our patient), 10 exhibited pure cerebellar ataxia, and 18 exhibited ataxia plus syndromes. We could not find an exact correlation between genotypes and phenotypes. Additionally, we established a precise molecular diagnosis in our patient’s family and extended the findings on the ethnic, phenotypic, and genotypic diversity of the SYNE1 mutational spectrum.
format Online
Article
Text
id pubmed-10236026
institution National Center for Biotechnology Information
language English
publishDate 2023
publisher The Korean Movement Disorder Society
record_format MEDLINE/PubMed
spelling pubmed-102360262023-06-03 Novel Compound Heterozygous Mutations in the SYNE1 Gene in a Taiwanese Family: A Case Report and Literature Review Kuo, Chia-Yan Yu, Pei Shan Chao, Chih-Ying Wang, Chun-Chieh Fan, Wen-Lang Wu, Yih-Ru J Mov Disord Case Report Mutations in the synaptic nuclear envelope protein 1 (SYNE1) gene are associated with substantial clinical heterogeneity. Here, we report the first case of SYNE1 ataxia in Taiwan due to two novel truncating mutations. Our patient, a 53-year-old female, exhibited pure cerebellar ataxia with c.1922del in exon 18 and c. C3883T mutations in exon 31. Previous studies have indicated that the prevalence of SYNE1 ataxia among East Asian populations is low. In this study, we identified 27 cases of SYNE1 ataxia from 22 families in East Asia. Of the 28 patients recruited in this study (including our patient), 10 exhibited pure cerebellar ataxia, and 18 exhibited ataxia plus syndromes. We could not find an exact correlation between genotypes and phenotypes. Additionally, we established a precise molecular diagnosis in our patient’s family and extended the findings on the ethnic, phenotypic, and genotypic diversity of the SYNE1 mutational spectrum. The Korean Movement Disorder Society 2023-05 2023-04-26 /pmc/articles/PMC10236026/ /pubmed/37096302 http://dx.doi.org/10.14802/jmd.22105 Text en Copyright © 2023 The Korean Movement Disorder Society https://creativecommons.org/licenses/by-nc/4.0/This is an Open Access article distributed under the terms of the Creative Commons Attribution Non-Commercial License (http://creativecommons.org/licenses/by-nc/4.0/ (https://creativecommons.org/licenses/by-nc/4.0/) ) which permits unrestricted non-commercial use, distribution, and reproduction in any medium, provided the original work is properly cited.
spellingShingle Case Report
Kuo, Chia-Yan
Yu, Pei Shan
Chao, Chih-Ying
Wang, Chun-Chieh
Fan, Wen-Lang
Wu, Yih-Ru
Novel Compound Heterozygous Mutations in the SYNE1 Gene in a Taiwanese Family: A Case Report and Literature Review
title Novel Compound Heterozygous Mutations in the SYNE1 Gene in a Taiwanese Family: A Case Report and Literature Review
title_full Novel Compound Heterozygous Mutations in the SYNE1 Gene in a Taiwanese Family: A Case Report and Literature Review
title_fullStr Novel Compound Heterozygous Mutations in the SYNE1 Gene in a Taiwanese Family: A Case Report and Literature Review
title_full_unstemmed Novel Compound Heterozygous Mutations in the SYNE1 Gene in a Taiwanese Family: A Case Report and Literature Review
title_short Novel Compound Heterozygous Mutations in the SYNE1 Gene in a Taiwanese Family: A Case Report and Literature Review
title_sort novel compound heterozygous mutations in the syne1 gene in a taiwanese family: a case report and literature review
topic Case Report
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10236026/
https://www.ncbi.nlm.nih.gov/pubmed/37096302
http://dx.doi.org/10.14802/jmd.22105
work_keys_str_mv AT kuochiayan novelcompoundheterozygousmutationsinthesyne1geneinataiwanesefamilyacasereportandliteraturereview
AT yupeishan novelcompoundheterozygousmutationsinthesyne1geneinataiwanesefamilyacasereportandliteraturereview
AT chaochihying novelcompoundheterozygousmutationsinthesyne1geneinataiwanesefamilyacasereportandliteraturereview
AT wangchunchieh novelcompoundheterozygousmutationsinthesyne1geneinataiwanesefamilyacasereportandliteraturereview
AT fanwenlang novelcompoundheterozygousmutationsinthesyne1geneinataiwanesefamilyacasereportandliteraturereview
AT wuyihru novelcompoundheterozygousmutationsinthesyne1geneinataiwanesefamilyacasereportandliteraturereview