Cargando…

Role of white matter hyperintensity in effects of apolipoprotein E on cognitive injury

Magnetic Resonance Imaging (MRI) T2-weighted white matter hyperintensity (WMH) is a marker of small vessel cerebrovascular pathology and is of ischemic origin. The prevalence and severity of WMH is associated with cardiovascular risk factors, aging, and cognitive injury in mild cognitive impairment...

Descripción completa

Detalles Bibliográficos
Autores principales: Raber, Jacob, Silbert, Lisa C.
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Frontiers Media S.A. 2023
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10237322/
https://www.ncbi.nlm.nih.gov/pubmed/37275347
http://dx.doi.org/10.3389/fnhum.2023.1176690
_version_ 1785053133036060672
author Raber, Jacob
Silbert, Lisa C.
author_facet Raber, Jacob
Silbert, Lisa C.
author_sort Raber, Jacob
collection PubMed
description Magnetic Resonance Imaging (MRI) T2-weighted white matter hyperintensity (WMH) is a marker of small vessel cerebrovascular pathology and is of ischemic origin. The prevalence and severity of WMH is associated with cardiovascular risk factors, aging, and cognitive injury in mild cognitive impairment (MCI), vascular dementia, and Alzheimer’s disease (AD). WMH especially affects executive function, with additional effects on memory and global cognition. Apolipoprotein E (apoE) plays a role in cholesterol metabolism and neuronal repair after injury. Human and animal studies support a role for apoE in maintaining white matter integrity. In humans, there are three major human apoE isoforms, E2, E3, and E4. Human apoE isoforms differ in risk to develop AD and in association with WMH. In this Mini Review, we propose an increased focus on the role of WMH in cognitive health and cognitive injury and the likely role of apoE and apoE isoform in modulating these effects. We hypothesize that apoE and apoE isoforms play a role in modulating WMH via apoE isoform-dependent effects on oxylipins and 7-ketocholesterol, as well as amyloid related vascular injury, as seen in cerebral amyloid angiopathy.
format Online
Article
Text
id pubmed-10237322
institution National Center for Biotechnology Information
language English
publishDate 2023
publisher Frontiers Media S.A.
record_format MEDLINE/PubMed
spelling pubmed-102373222023-06-03 Role of white matter hyperintensity in effects of apolipoprotein E on cognitive injury Raber, Jacob Silbert, Lisa C. Front Hum Neurosci Neuroscience Magnetic Resonance Imaging (MRI) T2-weighted white matter hyperintensity (WMH) is a marker of small vessel cerebrovascular pathology and is of ischemic origin. The prevalence and severity of WMH is associated with cardiovascular risk factors, aging, and cognitive injury in mild cognitive impairment (MCI), vascular dementia, and Alzheimer’s disease (AD). WMH especially affects executive function, with additional effects on memory and global cognition. Apolipoprotein E (apoE) plays a role in cholesterol metabolism and neuronal repair after injury. Human and animal studies support a role for apoE in maintaining white matter integrity. In humans, there are three major human apoE isoforms, E2, E3, and E4. Human apoE isoforms differ in risk to develop AD and in association with WMH. In this Mini Review, we propose an increased focus on the role of WMH in cognitive health and cognitive injury and the likely role of apoE and apoE isoform in modulating these effects. We hypothesize that apoE and apoE isoforms play a role in modulating WMH via apoE isoform-dependent effects on oxylipins and 7-ketocholesterol, as well as amyloid related vascular injury, as seen in cerebral amyloid angiopathy. Frontiers Media S.A. 2023-05-19 /pmc/articles/PMC10237322/ /pubmed/37275347 http://dx.doi.org/10.3389/fnhum.2023.1176690 Text en Copyright © 2023 Raber and Silbert. https://creativecommons.org/licenses/by/4.0/This is an open-access article distributed under the terms of the Creative Commons Attribution License (CC BY). The use, distribution or reproduction in other forums is permitted, provided the original author(s) and the copyright owner(s) are credited and that the original publication in this journal is cited, in accordance with accepted academic practice. No use, distribution or reproduction is permitted which does not comply with these terms.
spellingShingle Neuroscience
Raber, Jacob
Silbert, Lisa C.
Role of white matter hyperintensity in effects of apolipoprotein E on cognitive injury
title Role of white matter hyperintensity in effects of apolipoprotein E on cognitive injury
title_full Role of white matter hyperintensity in effects of apolipoprotein E on cognitive injury
title_fullStr Role of white matter hyperintensity in effects of apolipoprotein E on cognitive injury
title_full_unstemmed Role of white matter hyperintensity in effects of apolipoprotein E on cognitive injury
title_short Role of white matter hyperintensity in effects of apolipoprotein E on cognitive injury
title_sort role of white matter hyperintensity in effects of apolipoprotein e on cognitive injury
topic Neuroscience
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10237322/
https://www.ncbi.nlm.nih.gov/pubmed/37275347
http://dx.doi.org/10.3389/fnhum.2023.1176690
work_keys_str_mv AT raberjacob roleofwhitematterhyperintensityineffectsofapolipoproteineoncognitiveinjury
AT silbertlisac roleofwhitematterhyperintensityineffectsofapolipoproteineoncognitiveinjury