Cargando…

What are the pathways between poverty and malaria in sub-Saharan Africa? A systematic review of mediation studies

BACKGROUND: Malaria remains a major burden in sub-Saharan Africa (SSA). While an association between poverty and malaria has been demonstrated, a clearer understanding of explicit mechanisms through which socioeconomic position (SEP) influences malaria risk is needed to guide the design of more comp...

Descripción completa

Detalles Bibliográficos
Autores principales: Wafula, Solomon T., Habermann, Theresa, Franke, Mara Anna, May, Jürgen, Puradiredja, Dewi Ismajani, Lorenz, Eva, Brinkel, Johanna
Formato: Online Artículo Texto
Lenguaje:English
Publicado: BioMed Central 2023
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10249281/
https://www.ncbi.nlm.nih.gov/pubmed/37291664
http://dx.doi.org/10.1186/s40249-023-01110-2
_version_ 1785055527153172480
author Wafula, Solomon T.
Habermann, Theresa
Franke, Mara Anna
May, Jürgen
Puradiredja, Dewi Ismajani
Lorenz, Eva
Brinkel, Johanna
author_facet Wafula, Solomon T.
Habermann, Theresa
Franke, Mara Anna
May, Jürgen
Puradiredja, Dewi Ismajani
Lorenz, Eva
Brinkel, Johanna
author_sort Wafula, Solomon T.
collection PubMed
description BACKGROUND: Malaria remains a major burden in sub-Saharan Africa (SSA). While an association between poverty and malaria has been demonstrated, a clearer understanding of explicit mechanisms through which socioeconomic position (SEP) influences malaria risk is needed to guide the design of more comprehensive interventions for malaria risk mitigation. This systematic review provides an overview of the current evidence on the mediators of socioeconomic disparities in malaria in SSA. METHODS: We searched PubMed and Web of Science for randomised controlled trials, cohort, case-control and cross-sectional studies published in English between January 1, 2000 to May 31, 2022. Further studies were identified following reviews of reference lists of the studies included. We included studies that either (1) conducted a formal mediation analysis of risk factors on the causal pathway between SEP and malaria infections or (2) adjusted for these potential mediators as confounders on the association between SEP and malaria using standard regression models. At least two independent reviewers appraised the studies, conducted data extraction, and assessed risk of bias. A systematic overview is presented for the included studies. RESULTS: We identified 41 articles from 20 countries in SSA for inclusion in the final review. Of these, 30 studies used cross-sectional design, and 26 found socioeconomic inequalities in malaria risk. Three formal mediation analyses showed limited evidence of mediation of food security, housing quality, and previous antimalarial use. Housing, education, insecticide-treated nets, and nutrition were highlighted in the remaining studies as being protective against malaria independent of SEP, suggesting potential for mediation. However, methodological limitations included the use of cross-sectional data, insufficient confounder adjustment, heterogeneity in measuring both SEP and malaria, and generally low or moderate-quality studies. No studies considered exposure mediator interactions or considered identifiability assumptions. CONCLUSIONS: Few studies have conducted formal mediation analyses to elucidate pathways between SEP and malaria. Findings indicate that food security and housing could be more feasible (structural) intervention targets. Further research using well-designed longitudinal studies and improved analysis would illuminate the current sparse evidence into the pathways between SEP and malaria and adduce evidence for more potential targets for effective intervention. GRAPHICAL ABSTRACT: [Image: see text] SUPPLEMENTARY INFORMATION: The online version contains supplementary material available at 10.1186/s40249-023-01110-2.
format Online
Article
Text
id pubmed-10249281
institution National Center for Biotechnology Information
language English
publishDate 2023
publisher BioMed Central
record_format MEDLINE/PubMed
spelling pubmed-102492812023-06-09 What are the pathways between poverty and malaria in sub-Saharan Africa? A systematic review of mediation studies Wafula, Solomon T. Habermann, Theresa Franke, Mara Anna May, Jürgen Puradiredja, Dewi Ismajani Lorenz, Eva Brinkel, Johanna Infect Dis Poverty Scoping Review BACKGROUND: Malaria remains a major burden in sub-Saharan Africa (SSA). While an association between poverty and malaria has been demonstrated, a clearer understanding of explicit mechanisms through which socioeconomic position (SEP) influences malaria risk is needed to guide the design of more comprehensive interventions for malaria risk mitigation. This systematic review provides an overview of the current evidence on the mediators of socioeconomic disparities in malaria in SSA. METHODS: We searched PubMed and Web of Science for randomised controlled trials, cohort, case-control and cross-sectional studies published in English between January 1, 2000 to May 31, 2022. Further studies were identified following reviews of reference lists of the studies included. We included studies that either (1) conducted a formal mediation analysis of risk factors on the causal pathway between SEP and malaria infections or (2) adjusted for these potential mediators as confounders on the association between SEP and malaria using standard regression models. At least two independent reviewers appraised the studies, conducted data extraction, and assessed risk of bias. A systematic overview is presented for the included studies. RESULTS: We identified 41 articles from 20 countries in SSA for inclusion in the final review. Of these, 30 studies used cross-sectional design, and 26 found socioeconomic inequalities in malaria risk. Three formal mediation analyses showed limited evidence of mediation of food security, housing quality, and previous antimalarial use. Housing, education, insecticide-treated nets, and nutrition were highlighted in the remaining studies as being protective against malaria independent of SEP, suggesting potential for mediation. However, methodological limitations included the use of cross-sectional data, insufficient confounder adjustment, heterogeneity in measuring both SEP and malaria, and generally low or moderate-quality studies. No studies considered exposure mediator interactions or considered identifiability assumptions. CONCLUSIONS: Few studies have conducted formal mediation analyses to elucidate pathways between SEP and malaria. Findings indicate that food security and housing could be more feasible (structural) intervention targets. Further research using well-designed longitudinal studies and improved analysis would illuminate the current sparse evidence into the pathways between SEP and malaria and adduce evidence for more potential targets for effective intervention. GRAPHICAL ABSTRACT: [Image: see text] SUPPLEMENTARY INFORMATION: The online version contains supplementary material available at 10.1186/s40249-023-01110-2. BioMed Central 2023-06-08 /pmc/articles/PMC10249281/ /pubmed/37291664 http://dx.doi.org/10.1186/s40249-023-01110-2 Text en © The Author(s) 2023 https://creativecommons.org/licenses/by/4.0/Open Access This article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons licence, and indicate if changes were made. The images or other third party material in this article are included in the article's Creative Commons licence, unless indicated otherwise in a credit line to the material. If material is not included in the article's Creative Commons licence and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this licence, visit http://creativecommons.org/licenses/by/4.0/ (https://creativecommons.org/licenses/by/4.0/) . The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/ (https://creativecommons.org/publicdomain/zero/1.0/) ) applies to the data made available in this article, unless otherwise stated in a credit line to the data.
spellingShingle Scoping Review
Wafula, Solomon T.
Habermann, Theresa
Franke, Mara Anna
May, Jürgen
Puradiredja, Dewi Ismajani
Lorenz, Eva
Brinkel, Johanna
What are the pathways between poverty and malaria in sub-Saharan Africa? A systematic review of mediation studies
title What are the pathways between poverty and malaria in sub-Saharan Africa? A systematic review of mediation studies
title_full What are the pathways between poverty and malaria in sub-Saharan Africa? A systematic review of mediation studies
title_fullStr What are the pathways between poverty and malaria in sub-Saharan Africa? A systematic review of mediation studies
title_full_unstemmed What are the pathways between poverty and malaria in sub-Saharan Africa? A systematic review of mediation studies
title_short What are the pathways between poverty and malaria in sub-Saharan Africa? A systematic review of mediation studies
title_sort what are the pathways between poverty and malaria in sub-saharan africa? a systematic review of mediation studies
topic Scoping Review
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10249281/
https://www.ncbi.nlm.nih.gov/pubmed/37291664
http://dx.doi.org/10.1186/s40249-023-01110-2
work_keys_str_mv AT wafulasolomont whatarethepathwaysbetweenpovertyandmalariainsubsaharanafricaasystematicreviewofmediationstudies
AT habermanntheresa whatarethepathwaysbetweenpovertyandmalariainsubsaharanafricaasystematicreviewofmediationstudies
AT frankemaraanna whatarethepathwaysbetweenpovertyandmalariainsubsaharanafricaasystematicreviewofmediationstudies
AT mayjurgen whatarethepathwaysbetweenpovertyandmalariainsubsaharanafricaasystematicreviewofmediationstudies
AT puradiredjadewiismajani whatarethepathwaysbetweenpovertyandmalariainsubsaharanafricaasystematicreviewofmediationstudies
AT lorenzeva whatarethepathwaysbetweenpovertyandmalariainsubsaharanafricaasystematicreviewofmediationstudies
AT brinkeljohanna whatarethepathwaysbetweenpovertyandmalariainsubsaharanafricaasystematicreviewofmediationstudies