Cargando…

Midazolam impedes lung carcinoma cell proliferation and migration via EGFR/MEK/ERK signaling pathway

Non-small-cell lung cancer (NSCLC) is a dominating type of lung cancer with high morbidity and mortality. Midazolam has been reported to promote cell apoptosis in NSCLC, but the molecular mechanism of midazolam remains to be further explored. In the current work, cell viability, proliferation, migra...

Descripción completa

Detalles Bibliográficos
Autores principales: Zhang, Xiangchao, Han, Zhe, Li, Zhengjun, Wang, Tao
Formato: Online Artículo Texto
Lenguaje:English
Publicado: De Gruyter 2023
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10251164/
https://www.ncbi.nlm.nih.gov/pubmed/37305523
http://dx.doi.org/10.1515/med-2023-0730
_version_ 1785055894272212992
author Zhang, Xiangchao
Han, Zhe
Li, Zhengjun
Wang, Tao
author_facet Zhang, Xiangchao
Han, Zhe
Li, Zhengjun
Wang, Tao
author_sort Zhang, Xiangchao
collection PubMed
description Non-small-cell lung cancer (NSCLC) is a dominating type of lung cancer with high morbidity and mortality. Midazolam has been reported to promote cell apoptosis in NSCLC, but the molecular mechanism of midazolam remains to be further explored. In the current work, cell viability, proliferation, migration, and apoptosis rates of NSCLC cells treated with midazolam were measured using cell counting kit-8 assay, 5-ethynyl-2′-deoxyuridine (EdU) and colony formation assays, transwell, and flow cytometry assay, respectively, to evaluate the malignant behaviors. Western blot was applied to access EGFR/MEK/ERK pathway-related protein levels. The results demonstrated midazolam significantly declined the viability of NSCLC cells. Furthermore, midazolam restrained cell proliferation and migration and contributed to cell apoptosis in NSCLC. Midazolam exerted suppressive function to EGFR pathway during NSCLC development. Moreover, the activation of EGFR/MEK/ERK pathway abrogated the effects of midazolam on NSCLC cell proliferation, apoptosis, and migration. Taken together, midazolam exhibited anti-tumor effects hallmarked by EGFR pathway inhibition, providing a novel insight into the treatment of NSCLC.
format Online
Article
Text
id pubmed-10251164
institution National Center for Biotechnology Information
language English
publishDate 2023
publisher De Gruyter
record_format MEDLINE/PubMed
spelling pubmed-102511642023-06-10 Midazolam impedes lung carcinoma cell proliferation and migration via EGFR/MEK/ERK signaling pathway Zhang, Xiangchao Han, Zhe Li, Zhengjun Wang, Tao Open Med (Wars) Research Article Non-small-cell lung cancer (NSCLC) is a dominating type of lung cancer with high morbidity and mortality. Midazolam has been reported to promote cell apoptosis in NSCLC, but the molecular mechanism of midazolam remains to be further explored. In the current work, cell viability, proliferation, migration, and apoptosis rates of NSCLC cells treated with midazolam were measured using cell counting kit-8 assay, 5-ethynyl-2′-deoxyuridine (EdU) and colony formation assays, transwell, and flow cytometry assay, respectively, to evaluate the malignant behaviors. Western blot was applied to access EGFR/MEK/ERK pathway-related protein levels. The results demonstrated midazolam significantly declined the viability of NSCLC cells. Furthermore, midazolam restrained cell proliferation and migration and contributed to cell apoptosis in NSCLC. Midazolam exerted suppressive function to EGFR pathway during NSCLC development. Moreover, the activation of EGFR/MEK/ERK pathway abrogated the effects of midazolam on NSCLC cell proliferation, apoptosis, and migration. Taken together, midazolam exhibited anti-tumor effects hallmarked by EGFR pathway inhibition, providing a novel insight into the treatment of NSCLC. De Gruyter 2023-06-05 /pmc/articles/PMC10251164/ /pubmed/37305523 http://dx.doi.org/10.1515/med-2023-0730 Text en © 2023 the author(s), published by De Gruyter https://creativecommons.org/licenses/by/4.0/This work is licensed under the Creative Commons Attribution 4.0 International License.
spellingShingle Research Article
Zhang, Xiangchao
Han, Zhe
Li, Zhengjun
Wang, Tao
Midazolam impedes lung carcinoma cell proliferation and migration via EGFR/MEK/ERK signaling pathway
title Midazolam impedes lung carcinoma cell proliferation and migration via EGFR/MEK/ERK signaling pathway
title_full Midazolam impedes lung carcinoma cell proliferation and migration via EGFR/MEK/ERK signaling pathway
title_fullStr Midazolam impedes lung carcinoma cell proliferation and migration via EGFR/MEK/ERK signaling pathway
title_full_unstemmed Midazolam impedes lung carcinoma cell proliferation and migration via EGFR/MEK/ERK signaling pathway
title_short Midazolam impedes lung carcinoma cell proliferation and migration via EGFR/MEK/ERK signaling pathway
title_sort midazolam impedes lung carcinoma cell proliferation and migration via egfr/mek/erk signaling pathway
topic Research Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10251164/
https://www.ncbi.nlm.nih.gov/pubmed/37305523
http://dx.doi.org/10.1515/med-2023-0730
work_keys_str_mv AT zhangxiangchao midazolamimpedeslungcarcinomacellproliferationandmigrationviaegfrmekerksignalingpathway
AT hanzhe midazolamimpedeslungcarcinomacellproliferationandmigrationviaegfrmekerksignalingpathway
AT lizhengjun midazolamimpedeslungcarcinomacellproliferationandmigrationviaegfrmekerksignalingpathway
AT wangtao midazolamimpedeslungcarcinomacellproliferationandmigrationviaegfrmekerksignalingpathway