Cargando…

Recent Advances in Urinary Peptide and Proteomic Biomarkers in Chronic Kidney Disease: A Systematic Review

Biomarker development, improvement, and clinical implementation in the context of kidney disease have been a central focus of biomedical research for decades. To this point, only serum creatinine and urinary albumin excretion are well-accepted biomarkers in kidney disease. With their known blind spo...

Descripción completa

Detalles Bibliográficos
Autores principales: Catanese, Lorenzo, Siwy, Justyna, Mischak, Harald, Wendt, Ralph, Beige, Joachim, Rupprecht, Harald
Formato: Online Artículo Texto
Lenguaje:English
Publicado: MDPI 2023
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10252389/
https://www.ncbi.nlm.nih.gov/pubmed/37298105
http://dx.doi.org/10.3390/ijms24119156
_version_ 1785056159431917568
author Catanese, Lorenzo
Siwy, Justyna
Mischak, Harald
Wendt, Ralph
Beige, Joachim
Rupprecht, Harald
author_facet Catanese, Lorenzo
Siwy, Justyna
Mischak, Harald
Wendt, Ralph
Beige, Joachim
Rupprecht, Harald
author_sort Catanese, Lorenzo
collection PubMed
description Biomarker development, improvement, and clinical implementation in the context of kidney disease have been a central focus of biomedical research for decades. To this point, only serum creatinine and urinary albumin excretion are well-accepted biomarkers in kidney disease. With their known blind spot in the early stages of kidney impairment and their diagnostic limitations, there is a need for better and more specific biomarkers. With the rise in large-scale analyses of the thousands of peptides in serum or urine samples using mass spectrometry techniques, hopes for biomarker development are high. Advances in proteomic research have led to the discovery of an increasing amount of potential proteomic biomarkers and the identification of candidate biomarkers for clinical implementation in the context of kidney disease management. In this review that strictly follows the PRISMA guidelines, we focus on urinary peptide and especially peptidomic biomarkers emerging from recent research and underline the role of those with the highest potential for clinical implementation. The Web of Science database (all databases) was searched on 17 October 2022, using the search terms “marker *” OR biomarker * AND “renal disease” OR “kidney disease” AND “proteome *” OR “peptid *” AND “urin *”. English, full-text, original articles on humans published within the last 5 years were included, which had been cited at least five times per year. Studies based on animal models, renal transplant studies, metabolite studies, studies on miRNA, and studies on exosomal vesicles were excluded, focusing on urinary peptide biomarkers. The described search led to the identification of 3668 articles and the application of inclusion and exclusion criteria, as well as abstract and consecutive full-text analyses of three independent authors to reach a final number of 62 studies for this manuscript. The 62 manuscripts encompassed eight established single peptide biomarkers and several proteomic classifiers, including CKD273 and IgAN237. This review provides a summary of the recent evidence on single peptide urinary biomarkers in CKD, while emphasizing the increasing role of proteomic biomarker research with new research on established and new proteomic biomarkers. Lessons learned from the last 5 years in this review might encourage future studies, hopefully resulting in the routine clinical applicability of new biomarkers.
format Online
Article
Text
id pubmed-10252389
institution National Center for Biotechnology Information
language English
publishDate 2023
publisher MDPI
record_format MEDLINE/PubMed
spelling pubmed-102523892023-06-10 Recent Advances in Urinary Peptide and Proteomic Biomarkers in Chronic Kidney Disease: A Systematic Review Catanese, Lorenzo Siwy, Justyna Mischak, Harald Wendt, Ralph Beige, Joachim Rupprecht, Harald Int J Mol Sci Review Biomarker development, improvement, and clinical implementation in the context of kidney disease have been a central focus of biomedical research for decades. To this point, only serum creatinine and urinary albumin excretion are well-accepted biomarkers in kidney disease. With their known blind spot in the early stages of kidney impairment and their diagnostic limitations, there is a need for better and more specific biomarkers. With the rise in large-scale analyses of the thousands of peptides in serum or urine samples using mass spectrometry techniques, hopes for biomarker development are high. Advances in proteomic research have led to the discovery of an increasing amount of potential proteomic biomarkers and the identification of candidate biomarkers for clinical implementation in the context of kidney disease management. In this review that strictly follows the PRISMA guidelines, we focus on urinary peptide and especially peptidomic biomarkers emerging from recent research and underline the role of those with the highest potential for clinical implementation. The Web of Science database (all databases) was searched on 17 October 2022, using the search terms “marker *” OR biomarker * AND “renal disease” OR “kidney disease” AND “proteome *” OR “peptid *” AND “urin *”. English, full-text, original articles on humans published within the last 5 years were included, which had been cited at least five times per year. Studies based on animal models, renal transplant studies, metabolite studies, studies on miRNA, and studies on exosomal vesicles were excluded, focusing on urinary peptide biomarkers. The described search led to the identification of 3668 articles and the application of inclusion and exclusion criteria, as well as abstract and consecutive full-text analyses of three independent authors to reach a final number of 62 studies for this manuscript. The 62 manuscripts encompassed eight established single peptide biomarkers and several proteomic classifiers, including CKD273 and IgAN237. This review provides a summary of the recent evidence on single peptide urinary biomarkers in CKD, while emphasizing the increasing role of proteomic biomarker research with new research on established and new proteomic biomarkers. Lessons learned from the last 5 years in this review might encourage future studies, hopefully resulting in the routine clinical applicability of new biomarkers. MDPI 2023-05-23 /pmc/articles/PMC10252389/ /pubmed/37298105 http://dx.doi.org/10.3390/ijms24119156 Text en © 2023 by the authors. https://creativecommons.org/licenses/by/4.0/Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (https://creativecommons.org/licenses/by/4.0/).
spellingShingle Review
Catanese, Lorenzo
Siwy, Justyna
Mischak, Harald
Wendt, Ralph
Beige, Joachim
Rupprecht, Harald
Recent Advances in Urinary Peptide and Proteomic Biomarkers in Chronic Kidney Disease: A Systematic Review
title Recent Advances in Urinary Peptide and Proteomic Biomarkers in Chronic Kidney Disease: A Systematic Review
title_full Recent Advances in Urinary Peptide and Proteomic Biomarkers in Chronic Kidney Disease: A Systematic Review
title_fullStr Recent Advances in Urinary Peptide and Proteomic Biomarkers in Chronic Kidney Disease: A Systematic Review
title_full_unstemmed Recent Advances in Urinary Peptide and Proteomic Biomarkers in Chronic Kidney Disease: A Systematic Review
title_short Recent Advances in Urinary Peptide and Proteomic Biomarkers in Chronic Kidney Disease: A Systematic Review
title_sort recent advances in urinary peptide and proteomic biomarkers in chronic kidney disease: a systematic review
topic Review
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10252389/
https://www.ncbi.nlm.nih.gov/pubmed/37298105
http://dx.doi.org/10.3390/ijms24119156
work_keys_str_mv AT cataneselorenzo recentadvancesinurinarypeptideandproteomicbiomarkersinchronickidneydiseaseasystematicreview
AT siwyjustyna recentadvancesinurinarypeptideandproteomicbiomarkersinchronickidneydiseaseasystematicreview
AT mischakharald recentadvancesinurinarypeptideandproteomicbiomarkersinchronickidneydiseaseasystematicreview
AT wendtralph recentadvancesinurinarypeptideandproteomicbiomarkersinchronickidneydiseaseasystematicreview
AT beigejoachim recentadvancesinurinarypeptideandproteomicbiomarkersinchronickidneydiseaseasystematicreview
AT rupprechtharald recentadvancesinurinarypeptideandproteomicbiomarkersinchronickidneydiseaseasystematicreview