Cargando…
Design and Development of IoT and Deep Ensemble Learning Based Model for Disease Monitoring and Prediction
With the rapidly increasing reliance on advances in IoT, we persist towards pushing technology to new heights. From ordering food online to gene editing-based personalized healthcare, disruptive technologies like ML and AI continue to grow beyond our wildest dreams. Early detection and treatment thr...
Autores principales: | , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
MDPI
2023
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10252597/ https://www.ncbi.nlm.nih.gov/pubmed/37296794 http://dx.doi.org/10.3390/diagnostics13111942 |
_version_ | 1785056208998105088 |
---|---|
author | Venkatachala Appa Swamy, Mareeswari Periyasamy, Jayalakshmi Thangavel, Muthamilselvan Khan, Surbhi B. Almusharraf, Ahlam Santhanam, Prasanna Ramaraj, Vijayan Elsisi, Mahmoud |
author_facet | Venkatachala Appa Swamy, Mareeswari Periyasamy, Jayalakshmi Thangavel, Muthamilselvan Khan, Surbhi B. Almusharraf, Ahlam Santhanam, Prasanna Ramaraj, Vijayan Elsisi, Mahmoud |
author_sort | Venkatachala Appa Swamy, Mareeswari |
collection | PubMed |
description | With the rapidly increasing reliance on advances in IoT, we persist towards pushing technology to new heights. From ordering food online to gene editing-based personalized healthcare, disruptive technologies like ML and AI continue to grow beyond our wildest dreams. Early detection and treatment through AI-assisted diagnostic models have outperformed human intelligence. In many cases, these tools can act upon the structured data containing probable symptoms, offer medication schedules based on the appropriate code related to diagnosis conventions, and predict adverse drug effects, if any, in accordance with medications. Utilizing AI and IoT in healthcare has facilitated innumerable benefits like minimizing cost, reducing hospital-obtained infections, decreasing mortality and morbidity etc. DL algorithms have opened up several frontiers by contributing towards healthcare opportunities through their ability to understand and learn from different levels of demonstration and generalization, which is significant in data analysis and interpretation. In contrast to ML which relies more on structured, labeled data and domain expertise to facilitate feature extractions, DL employs human-like cognitive abilities to extract hidden relationships and patterns from uncategorized data. Through the efficient application of DL techniques on the medical dataset, precise prediction, and classification of infectious/rare diseases, avoiding surgeries that can be preventable, minimization of over-dosage of harmful contrast agents for scans and biopsies can be reduced to a greater extent in future. Our study is focused on deploying ensemble deep learning algorithms and IoT devices to design and develop a diagnostic model that can effectively analyze medical Big Data and diagnose diseases by identifying abnormalities in early stages through medical images provided as input. This AI-assisted diagnostic model based on Ensemble Deep learning aims to be a valuable tool for healthcare systems and patients through its ability to diagnose diseases in the initial stages and present valuable insights to facilitate personalized treatment by aggregating the prediction of each base model and generating a final prediction. |
format | Online Article Text |
id | pubmed-10252597 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2023 |
publisher | MDPI |
record_format | MEDLINE/PubMed |
spelling | pubmed-102525972023-06-10 Design and Development of IoT and Deep Ensemble Learning Based Model for Disease Monitoring and Prediction Venkatachala Appa Swamy, Mareeswari Periyasamy, Jayalakshmi Thangavel, Muthamilselvan Khan, Surbhi B. Almusharraf, Ahlam Santhanam, Prasanna Ramaraj, Vijayan Elsisi, Mahmoud Diagnostics (Basel) Article With the rapidly increasing reliance on advances in IoT, we persist towards pushing technology to new heights. From ordering food online to gene editing-based personalized healthcare, disruptive technologies like ML and AI continue to grow beyond our wildest dreams. Early detection and treatment through AI-assisted diagnostic models have outperformed human intelligence. In many cases, these tools can act upon the structured data containing probable symptoms, offer medication schedules based on the appropriate code related to diagnosis conventions, and predict adverse drug effects, if any, in accordance with medications. Utilizing AI and IoT in healthcare has facilitated innumerable benefits like minimizing cost, reducing hospital-obtained infections, decreasing mortality and morbidity etc. DL algorithms have opened up several frontiers by contributing towards healthcare opportunities through their ability to understand and learn from different levels of demonstration and generalization, which is significant in data analysis and interpretation. In contrast to ML which relies more on structured, labeled data and domain expertise to facilitate feature extractions, DL employs human-like cognitive abilities to extract hidden relationships and patterns from uncategorized data. Through the efficient application of DL techniques on the medical dataset, precise prediction, and classification of infectious/rare diseases, avoiding surgeries that can be preventable, minimization of over-dosage of harmful contrast agents for scans and biopsies can be reduced to a greater extent in future. Our study is focused on deploying ensemble deep learning algorithms and IoT devices to design and develop a diagnostic model that can effectively analyze medical Big Data and diagnose diseases by identifying abnormalities in early stages through medical images provided as input. This AI-assisted diagnostic model based on Ensemble Deep learning aims to be a valuable tool for healthcare systems and patients through its ability to diagnose diseases in the initial stages and present valuable insights to facilitate personalized treatment by aggregating the prediction of each base model and generating a final prediction. MDPI 2023-06-01 /pmc/articles/PMC10252597/ /pubmed/37296794 http://dx.doi.org/10.3390/diagnostics13111942 Text en © 2023 by the authors. https://creativecommons.org/licenses/by/4.0/Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (https://creativecommons.org/licenses/by/4.0/). |
spellingShingle | Article Venkatachala Appa Swamy, Mareeswari Periyasamy, Jayalakshmi Thangavel, Muthamilselvan Khan, Surbhi B. Almusharraf, Ahlam Santhanam, Prasanna Ramaraj, Vijayan Elsisi, Mahmoud Design and Development of IoT and Deep Ensemble Learning Based Model for Disease Monitoring and Prediction |
title | Design and Development of IoT and Deep Ensemble Learning Based Model for Disease Monitoring and Prediction |
title_full | Design and Development of IoT and Deep Ensemble Learning Based Model for Disease Monitoring and Prediction |
title_fullStr | Design and Development of IoT and Deep Ensemble Learning Based Model for Disease Monitoring and Prediction |
title_full_unstemmed | Design and Development of IoT and Deep Ensemble Learning Based Model for Disease Monitoring and Prediction |
title_short | Design and Development of IoT and Deep Ensemble Learning Based Model for Disease Monitoring and Prediction |
title_sort | design and development of iot and deep ensemble learning based model for disease monitoring and prediction |
topic | Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10252597/ https://www.ncbi.nlm.nih.gov/pubmed/37296794 http://dx.doi.org/10.3390/diagnostics13111942 |
work_keys_str_mv | AT venkatachalaappaswamymareeswari designanddevelopmentofiotanddeepensemblelearningbasedmodelfordiseasemonitoringandprediction AT periyasamyjayalakshmi designanddevelopmentofiotanddeepensemblelearningbasedmodelfordiseasemonitoringandprediction AT thangavelmuthamilselvan designanddevelopmentofiotanddeepensemblelearningbasedmodelfordiseasemonitoringandprediction AT khansurbhib designanddevelopmentofiotanddeepensemblelearningbasedmodelfordiseasemonitoringandprediction AT almusharrafahlam designanddevelopmentofiotanddeepensemblelearningbasedmodelfordiseasemonitoringandprediction AT santhanamprasanna designanddevelopmentofiotanddeepensemblelearningbasedmodelfordiseasemonitoringandprediction AT ramarajvijayan designanddevelopmentofiotanddeepensemblelearningbasedmodelfordiseasemonitoringandprediction AT elsisimahmoud designanddevelopmentofiotanddeepensemblelearningbasedmodelfordiseasemonitoringandprediction |