Cargando…

Challenges in addiction-affected families: a systematic review of qualitative studies

BACKGROUND: The relative paucity of research on Addiction-Affected Families’ (AAF) issues and the lack of attention given to their difficulties and treatment in interventions and clinical practices indicate that the primary focus consistently revolves around individuals with addictive disorders, eve...

Descripción completa

Detalles Bibliográficos
Autores principales: Mardani, Mostafa, Alipour, Fardin, Rafiey, Hassan, Fallahi-Khoshknab, Masoud, Arshi, Maliheh
Formato: Online Artículo Texto
Lenguaje:English
Publicado: BioMed Central 2023
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10273571/
https://www.ncbi.nlm.nih.gov/pubmed/37328763
http://dx.doi.org/10.1186/s12888-023-04927-1
_version_ 1785059688691269632
author Mardani, Mostafa
Alipour, Fardin
Rafiey, Hassan
Fallahi-Khoshknab, Masoud
Arshi, Maliheh
author_facet Mardani, Mostafa
Alipour, Fardin
Rafiey, Hassan
Fallahi-Khoshknab, Masoud
Arshi, Maliheh
author_sort Mardani, Mostafa
collection PubMed
description BACKGROUND: The relative paucity of research on Addiction-Affected Families’ (AAF) issues and the lack of attention given to their difficulties and treatment in interventions and clinical practices indicate that the primary focus consistently revolves around individuals with addictive disorders, even when the treatment process involves their families. However, it is believed that family members endure significant pressures that result in extensive negative consequences on the personal, familial, and social aspects of their lives. Aiming for a better understanding of the challenges and issues that AAF’s experience, this systematic review explored qualitative studies with a focus on the impact of addiction on different aspects of families. METHODS: We searched Research Gate, Scopus, Web of Science, ProQuest, Elsevier, and Google Scholar Databases. We included studies of qualitative design which have investigated the effects of addiction on families. Non-English language studies, medical views, and quantitative approaches were excluded. Participants in the selected studies included parents, children, couples, sisters/brothers, relatives, drug users and specialists. The data from the selected studies were extracted using a standard format for the systematic review of qualitative research (the National Institute of Health and Care Excellence [NICE] 2102a). RESULTS: A thematic analysis of the findings of the studies identified 5 main themes: 1) initial shock (family encounter, searching for why), 2) family in the fog (social isolation, stigma and label), 3) sequence of disorders (emotional decline, negative behavioral experiences, mental disturbance, physical degeneration, family burden), 4) internal family chaos (instability of relationships, shadow people, erosive confrontation with the drug-using member, a newly emerging member, collapsing system, financial collapse), and 5) self-protection (attracting information, support, and protective sources, coping and adjusting the effects, the emergence of spirituality). CONCLUSION: This systematic review of qualitative research highlights the various and complex issues which addiction-affected families go through in terms of financial, social, cultural, mental and physical health problems, as a result of which experts of the field are needed to investigate and take measures. The findings can inform policy and practice and the development of interventions aimed to lighten the burdens which addiction-affected families carry.
format Online
Article
Text
id pubmed-10273571
institution National Center for Biotechnology Information
language English
publishDate 2023
publisher BioMed Central
record_format MEDLINE/PubMed
spelling pubmed-102735712023-06-17 Challenges in addiction-affected families: a systematic review of qualitative studies Mardani, Mostafa Alipour, Fardin Rafiey, Hassan Fallahi-Khoshknab, Masoud Arshi, Maliheh BMC Psychiatry Research BACKGROUND: The relative paucity of research on Addiction-Affected Families’ (AAF) issues and the lack of attention given to their difficulties and treatment in interventions and clinical practices indicate that the primary focus consistently revolves around individuals with addictive disorders, even when the treatment process involves their families. However, it is believed that family members endure significant pressures that result in extensive negative consequences on the personal, familial, and social aspects of their lives. Aiming for a better understanding of the challenges and issues that AAF’s experience, this systematic review explored qualitative studies with a focus on the impact of addiction on different aspects of families. METHODS: We searched Research Gate, Scopus, Web of Science, ProQuest, Elsevier, and Google Scholar Databases. We included studies of qualitative design which have investigated the effects of addiction on families. Non-English language studies, medical views, and quantitative approaches were excluded. Participants in the selected studies included parents, children, couples, sisters/brothers, relatives, drug users and specialists. The data from the selected studies were extracted using a standard format for the systematic review of qualitative research (the National Institute of Health and Care Excellence [NICE] 2102a). RESULTS: A thematic analysis of the findings of the studies identified 5 main themes: 1) initial shock (family encounter, searching for why), 2) family in the fog (social isolation, stigma and label), 3) sequence of disorders (emotional decline, negative behavioral experiences, mental disturbance, physical degeneration, family burden), 4) internal family chaos (instability of relationships, shadow people, erosive confrontation with the drug-using member, a newly emerging member, collapsing system, financial collapse), and 5) self-protection (attracting information, support, and protective sources, coping and adjusting the effects, the emergence of spirituality). CONCLUSION: This systematic review of qualitative research highlights the various and complex issues which addiction-affected families go through in terms of financial, social, cultural, mental and physical health problems, as a result of which experts of the field are needed to investigate and take measures. The findings can inform policy and practice and the development of interventions aimed to lighten the burdens which addiction-affected families carry. BioMed Central 2023-06-16 /pmc/articles/PMC10273571/ /pubmed/37328763 http://dx.doi.org/10.1186/s12888-023-04927-1 Text en © The Author(s) 2023 https://creativecommons.org/licenses/by/4.0/Open Access This article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons licence, and indicate if changes were made. The images or other third party material in this article are included in the article's Creative Commons licence, unless indicated otherwise in a credit line to the material. If material is not included in the article's Creative Commons licence and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this licence, visit http://creativecommons.org/licenses/by/4.0/ (https://creativecommons.org/licenses/by/4.0/) . The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/ (https://creativecommons.org/publicdomain/zero/1.0/) ) applies to the data made available in this article, unless otherwise stated in a credit line to the data.
spellingShingle Research
Mardani, Mostafa
Alipour, Fardin
Rafiey, Hassan
Fallahi-Khoshknab, Masoud
Arshi, Maliheh
Challenges in addiction-affected families: a systematic review of qualitative studies
title Challenges in addiction-affected families: a systematic review of qualitative studies
title_full Challenges in addiction-affected families: a systematic review of qualitative studies
title_fullStr Challenges in addiction-affected families: a systematic review of qualitative studies
title_full_unstemmed Challenges in addiction-affected families: a systematic review of qualitative studies
title_short Challenges in addiction-affected families: a systematic review of qualitative studies
title_sort challenges in addiction-affected families: a systematic review of qualitative studies
topic Research
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10273571/
https://www.ncbi.nlm.nih.gov/pubmed/37328763
http://dx.doi.org/10.1186/s12888-023-04927-1
work_keys_str_mv AT mardanimostafa challengesinaddictionaffectedfamiliesasystematicreviewofqualitativestudies
AT alipourfardin challengesinaddictionaffectedfamiliesasystematicreviewofqualitativestudies
AT rafieyhassan challengesinaddictionaffectedfamiliesasystematicreviewofqualitativestudies
AT fallahikhoshknabmasoud challengesinaddictionaffectedfamiliesasystematicreviewofqualitativestudies
AT arshimaliheh challengesinaddictionaffectedfamiliesasystematicreviewofqualitativestudies