Cargando…

Trustworthy management in hospital settings: a systematic review

BACKGROUND: Trustful relationships play a vital role in successful organisations and well-functioning hospitals. While the trust relationship between patients and providers has been widely studied, trust relations between healthcare professionals and their supervisors have not been emphasised. A sys...

Descripción completa

Detalles Bibliográficos
Autores principales: Varga, Andreea Isabela, Spehar, Ivan, Skirbekk, Helge
Formato: Online Artículo Texto
Lenguaje:English
Publicado: BioMed Central 2023
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10283186/
https://www.ncbi.nlm.nih.gov/pubmed/37340412
http://dx.doi.org/10.1186/s12913-023-09610-5
_version_ 1785061255340359680
author Varga, Andreea Isabela
Spehar, Ivan
Skirbekk, Helge
author_facet Varga, Andreea Isabela
Spehar, Ivan
Skirbekk, Helge
author_sort Varga, Andreea Isabela
collection PubMed
description BACKGROUND: Trustful relationships play a vital role in successful organisations and well-functioning hospitals. While the trust relationship between patients and providers has been widely studied, trust relations between healthcare professionals and their supervisors have not been emphasised. A systematic literature review was conducted to map and provide an overview of the characteristics of trustworthy management in a hospital setting. METHODS: We searched Web of Science, Embase, MEDLINE, APA PsycInfo, CINAHL, Scopus, EconLit, Taylor & Francis Online, SAGE Journals and Springer Link from database inception up until Aug 9, 2021. Empirical studies written in English undertaken in a hospital or similar setting and addressed trust relationships between healthcare professionals and their supervisors were included, without date restrictions. Records were independently screened for eligibility by two researchers. One researcher extracted the data and another one checked the correctness. A narrative approach, which involves textual and tabular summaries of findings, was undertaken in synthesising and analysing the data. Risk of bias was assessed independently by two researchers using two critical appraisal tools. Most of the included studies were assessed as acceptable, with some associated risk of bias. RESULTS: Of 7414 records identified, 18 were included. 12 were quantitative papers and 6 were qualitative. The findings were conceptualised in two categories that were associated with trust in management, namely leadership behaviours and organisational factors. Most studies (n = 15) explored the former, while the rest (n = 3) additionally explored the latter. Leadership behaviours most commonly associated with employee’s trust in their supervisors include (a) different facets of ethical leadership, such as integrity, moral leadership and fairness; (b) caring for employee’s well-being conceptualised as benevolence, supportiveness and showing concern and (c) the manager’s availability measured as being accessible and approachable. Additionally, four studies found that leaders’ competence were related to perceptions of trust. Empowering work environments were most commonly associated with trust in management. CONCLUSIONS: Ethical leadership, caring for employees’ well-being, manager’s availability, competence and an empowering work environment are characteristics associated with trustworthy management. Future research could explore the interplay between leadership behaviours and organisational factors in eliciting trust in management. SUPPLEMENTARY INFORMATION: The online version contains supplementary material available at 10.1186/s12913-023-09610-5.
format Online
Article
Text
id pubmed-10283186
institution National Center for Biotechnology Information
language English
publishDate 2023
publisher BioMed Central
record_format MEDLINE/PubMed
spelling pubmed-102831862023-06-22 Trustworthy management in hospital settings: a systematic review Varga, Andreea Isabela Spehar, Ivan Skirbekk, Helge BMC Health Serv Res Research BACKGROUND: Trustful relationships play a vital role in successful organisations and well-functioning hospitals. While the trust relationship between patients and providers has been widely studied, trust relations between healthcare professionals and their supervisors have not been emphasised. A systematic literature review was conducted to map and provide an overview of the characteristics of trustworthy management in a hospital setting. METHODS: We searched Web of Science, Embase, MEDLINE, APA PsycInfo, CINAHL, Scopus, EconLit, Taylor & Francis Online, SAGE Journals and Springer Link from database inception up until Aug 9, 2021. Empirical studies written in English undertaken in a hospital or similar setting and addressed trust relationships between healthcare professionals and their supervisors were included, without date restrictions. Records were independently screened for eligibility by two researchers. One researcher extracted the data and another one checked the correctness. A narrative approach, which involves textual and tabular summaries of findings, was undertaken in synthesising and analysing the data. Risk of bias was assessed independently by two researchers using two critical appraisal tools. Most of the included studies were assessed as acceptable, with some associated risk of bias. RESULTS: Of 7414 records identified, 18 were included. 12 were quantitative papers and 6 were qualitative. The findings were conceptualised in two categories that were associated with trust in management, namely leadership behaviours and organisational factors. Most studies (n = 15) explored the former, while the rest (n = 3) additionally explored the latter. Leadership behaviours most commonly associated with employee’s trust in their supervisors include (a) different facets of ethical leadership, such as integrity, moral leadership and fairness; (b) caring for employee’s well-being conceptualised as benevolence, supportiveness and showing concern and (c) the manager’s availability measured as being accessible and approachable. Additionally, four studies found that leaders’ competence were related to perceptions of trust. Empowering work environments were most commonly associated with trust in management. CONCLUSIONS: Ethical leadership, caring for employees’ well-being, manager’s availability, competence and an empowering work environment are characteristics associated with trustworthy management. Future research could explore the interplay between leadership behaviours and organisational factors in eliciting trust in management. SUPPLEMENTARY INFORMATION: The online version contains supplementary material available at 10.1186/s12913-023-09610-5. BioMed Central 2023-06-20 /pmc/articles/PMC10283186/ /pubmed/37340412 http://dx.doi.org/10.1186/s12913-023-09610-5 Text en © The Author(s) 2023 https://creativecommons.org/licenses/by/4.0/Open Access This article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons licence, and indicate if changes were made. The images or other third party material in this article are included in the article’s Creative Commons licence, unless indicated otherwise in a credit line to the material. If material is not included in the article’s Creative Commons licence and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this licence, visit http://creativecommons.org/licenses/by/4.0/ (https://creativecommons.org/licenses/by/4.0/) . The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/ (https://creativecommons.org/publicdomain/zero/1.0/) ) applies to the data made available in this article, unless otherwise stated in a credit line to the data.
spellingShingle Research
Varga, Andreea Isabela
Spehar, Ivan
Skirbekk, Helge
Trustworthy management in hospital settings: a systematic review
title Trustworthy management in hospital settings: a systematic review
title_full Trustworthy management in hospital settings: a systematic review
title_fullStr Trustworthy management in hospital settings: a systematic review
title_full_unstemmed Trustworthy management in hospital settings: a systematic review
title_short Trustworthy management in hospital settings: a systematic review
title_sort trustworthy management in hospital settings: a systematic review
topic Research
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10283186/
https://www.ncbi.nlm.nih.gov/pubmed/37340412
http://dx.doi.org/10.1186/s12913-023-09610-5
work_keys_str_mv AT vargaandreeaisabela trustworthymanagementinhospitalsettingsasystematicreview
AT speharivan trustworthymanagementinhospitalsettingsasystematicreview
AT skirbekkhelge trustworthymanagementinhospitalsettingsasystematicreview