Cargando…
Availability and accessibility of HIV self-tests and self-sample kits at community pharmacies in the Netherlands
BACKGROUND: In 2016 the WHO declared HIV self-testing and self-sampling an effective and safe test option that can reduce testing barriers. HIV self-tests and self-sampling kits (HIVST/HIVSS) are available for purchase at Dutch community pharmacies since 2019. We investigated the availability and ac...
Autores principales: | , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
BioMed Central
2023
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10288660/ https://www.ncbi.nlm.nih.gov/pubmed/37349835 http://dx.doi.org/10.1186/s12981-023-00529-9 |
_version_ | 1785062115548069888 |
---|---|
author | Kandil, Chaima Hugtenburg, Jacqueline Heijman, Titia Bos, Hanna Teichert, Martina Finkenflügel, Renee de Coul, Eline Op |
author_facet | Kandil, Chaima Hugtenburg, Jacqueline Heijman, Titia Bos, Hanna Teichert, Martina Finkenflügel, Renee de Coul, Eline Op |
author_sort | Kandil, Chaima |
collection | PubMed |
description | BACKGROUND: In 2016 the WHO declared HIV self-testing and self-sampling an effective and safe test option that can reduce testing barriers. HIV self-tests and self-sampling kits (HIVST/HIVSS) are available for purchase at Dutch community pharmacies since 2019. We investigated the availability and accessibility of HIVST/HIVSS in community pharmacies, and factors associated with test availability. METHODS: An online survey among all Dutch community pharmacies (n = 1,987) was conducted between April and June 2021. Availability of HIVST/HIVSS and experiences of pharmacists with the test offer were analyzed with descriptive statistics. The association of pharmacy and pharmacists’ characteristics with HIVST/HIVSS availability was explored by logistic regression analysis. RESULTS: In total, 465 pharmacists completed the questionnaire. Of the responding pharmacists, 6.2% (n = 29) offered HIVST/HIVSS. The majority (82.8%) sold between 0 and 20 tests per year. In total, pharmacies sold an estimated 370 HIVST/HIVSS per year. Pharmacies having HIVST/HIVSS available were less often located in moderately-urbanized to rural neighborhoods (OR 0.35, 95%CI 0.16–0.77 versus highly-urbanized), and were less often located in moderate-to-low SES neighborhoods (OR 0.40, 95%CI 0.18–0.88 versus high-SES). Reasons for not offering HIVST/HIVSS by pharmacists were no or little demand (69.3%), and not being familiar with these tests (17.4%). 52% of the pharmacists provided information about testing to test buyers. Reported options to improve the test offer were giving advice about (performing) the test to test buyers (72.4%), placing tests visible on the counter (51.7%), and advertisement (37.9%). CONCLUSION: HIVST/HIVSS have a limited practical availability in Dutch community pharmacies since their introduction in 2019, especially in lower-urbanized and lower-SES areas. Further research is needed to explore how to expand access to HIVST/HIVSS through community pharmacies in the Netherlands, and how to tailor it to the needs of pharmacy clients. |
format | Online Article Text |
id | pubmed-10288660 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2023 |
publisher | BioMed Central |
record_format | MEDLINE/PubMed |
spelling | pubmed-102886602023-06-24 Availability and accessibility of HIV self-tests and self-sample kits at community pharmacies in the Netherlands Kandil, Chaima Hugtenburg, Jacqueline Heijman, Titia Bos, Hanna Teichert, Martina Finkenflügel, Renee de Coul, Eline Op AIDS Res Ther Research BACKGROUND: In 2016 the WHO declared HIV self-testing and self-sampling an effective and safe test option that can reduce testing barriers. HIV self-tests and self-sampling kits (HIVST/HIVSS) are available for purchase at Dutch community pharmacies since 2019. We investigated the availability and accessibility of HIVST/HIVSS in community pharmacies, and factors associated with test availability. METHODS: An online survey among all Dutch community pharmacies (n = 1,987) was conducted between April and June 2021. Availability of HIVST/HIVSS and experiences of pharmacists with the test offer were analyzed with descriptive statistics. The association of pharmacy and pharmacists’ characteristics with HIVST/HIVSS availability was explored by logistic regression analysis. RESULTS: In total, 465 pharmacists completed the questionnaire. Of the responding pharmacists, 6.2% (n = 29) offered HIVST/HIVSS. The majority (82.8%) sold between 0 and 20 tests per year. In total, pharmacies sold an estimated 370 HIVST/HIVSS per year. Pharmacies having HIVST/HIVSS available were less often located in moderately-urbanized to rural neighborhoods (OR 0.35, 95%CI 0.16–0.77 versus highly-urbanized), and were less often located in moderate-to-low SES neighborhoods (OR 0.40, 95%CI 0.18–0.88 versus high-SES). Reasons for not offering HIVST/HIVSS by pharmacists were no or little demand (69.3%), and not being familiar with these tests (17.4%). 52% of the pharmacists provided information about testing to test buyers. Reported options to improve the test offer were giving advice about (performing) the test to test buyers (72.4%), placing tests visible on the counter (51.7%), and advertisement (37.9%). CONCLUSION: HIVST/HIVSS have a limited practical availability in Dutch community pharmacies since their introduction in 2019, especially in lower-urbanized and lower-SES areas. Further research is needed to explore how to expand access to HIVST/HIVSS through community pharmacies in the Netherlands, and how to tailor it to the needs of pharmacy clients. BioMed Central 2023-06-22 /pmc/articles/PMC10288660/ /pubmed/37349835 http://dx.doi.org/10.1186/s12981-023-00529-9 Text en © The Author(s) 2023 https://creativecommons.org/licenses/by/4.0/Open Access This article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons licence, and indicate if changes were made. The images or other third party material in this article are included in the article’s Creative Commons licence, unless indicated otherwise in a credit line to the material. If material is not included in the article’s Creative Commons licence and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this licence, visit http://creativecommons.org/licenses/by/4.0/ (https://creativecommons.org/licenses/by/4.0/) . The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/ (https://creativecommons.org/publicdomain/zero/1.0/) ) applies to the data made available in this article, unless otherwise stated in a credit line to the data. |
spellingShingle | Research Kandil, Chaima Hugtenburg, Jacqueline Heijman, Titia Bos, Hanna Teichert, Martina Finkenflügel, Renee de Coul, Eline Op Availability and accessibility of HIV self-tests and self-sample kits at community pharmacies in the Netherlands |
title | Availability and accessibility of HIV self-tests and self-sample kits at community pharmacies in the Netherlands |
title_full | Availability and accessibility of HIV self-tests and self-sample kits at community pharmacies in the Netherlands |
title_fullStr | Availability and accessibility of HIV self-tests and self-sample kits at community pharmacies in the Netherlands |
title_full_unstemmed | Availability and accessibility of HIV self-tests and self-sample kits at community pharmacies in the Netherlands |
title_short | Availability and accessibility of HIV self-tests and self-sample kits at community pharmacies in the Netherlands |
title_sort | availability and accessibility of hiv self-tests and self-sample kits at community pharmacies in the netherlands |
topic | Research |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10288660/ https://www.ncbi.nlm.nih.gov/pubmed/37349835 http://dx.doi.org/10.1186/s12981-023-00529-9 |
work_keys_str_mv | AT kandilchaima availabilityandaccessibilityofhivselftestsandselfsamplekitsatcommunitypharmaciesinthenetherlands AT hugtenburgjacqueline availabilityandaccessibilityofhivselftestsandselfsamplekitsatcommunitypharmaciesinthenetherlands AT heijmantitia availabilityandaccessibilityofhivselftestsandselfsamplekitsatcommunitypharmaciesinthenetherlands AT boshanna availabilityandaccessibilityofhivselftestsandselfsamplekitsatcommunitypharmaciesinthenetherlands AT teichertmartina availabilityandaccessibilityofhivselftestsandselfsamplekitsatcommunitypharmaciesinthenetherlands AT finkenflugelrenee availabilityandaccessibilityofhivselftestsandselfsamplekitsatcommunitypharmaciesinthenetherlands AT decoulelineop availabilityandaccessibilityofhivselftestsandselfsamplekitsatcommunitypharmaciesinthenetherlands |