Cargando…
Hospital disaster preparedness in sub-Saharan Africa: a systematic review of English literature
BACKGROUND: Disasters are increasing worldwide, with Sub-Saharan Africa (SSA) being one of the most prone regions. Hospitals play a key role in disasters. This study provides a systematic review of the evidence on disaster preparedness by hospitals in SSA countries based on English literature. METHO...
Autores principales: | , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
BioMed Central
2023
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10291806/ https://www.ncbi.nlm.nih.gov/pubmed/37365529 http://dx.doi.org/10.1186/s12873-023-00843-5 |
_version_ | 1785062759471251456 |
---|---|
author | Farah, Bashir Pavlova, Milena Groot, Wim |
author_facet | Farah, Bashir Pavlova, Milena Groot, Wim |
author_sort | Farah, Bashir |
collection | PubMed |
description | BACKGROUND: Disasters are increasing worldwide, with Sub-Saharan Africa (SSA) being one of the most prone regions. Hospitals play a key role in disasters. This study provides a systematic review of the evidence on disaster preparedness by hospitals in SSA countries based on English literature. METHODS: A systematic literature review was conducted of articles published between January 2012 and July 2022. We searched PubMed, Elsevier, Science Direct, Google Scholar, the WHO depository library and CDC sites for English language publications. The key inclusion criteria were: publications should have been published in the above period, deal with hospital disaster preparedness in SSA, the full paper should have been available, and studies should have presented a comparison between hospitals and/or a single hospital. RESULTS: Results indicate improvements in disaster preparedness over time. However, health systems in SSA are generally considered vulnerable, and they find it difficult to adapt to changing health conditions. Inadequately skilled healthcare professionals, underfunding, poor knowledge, the absence of governance and leadership, lack of transparency and bureaucracy are the main preparedness barriers. Some countries are in an infancy stage of their health system development, while others are among the least developed health system in the world. Finally, a major barrier to disaster preparedness in SSA countries is the inability to collaborate in disaster response. CONCLUSIONS: Hospital disaster preparedness is vulnerable in SSA countries. Thus, improvement of hospital disaster preparedness is highly needed. SUPPLEMENTARY INFORMATION: The online version contains supplementary material available at 10.1186/s12873-023-00843-5. |
format | Online Article Text |
id | pubmed-10291806 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2023 |
publisher | BioMed Central |
record_format | MEDLINE/PubMed |
spelling | pubmed-102918062023-06-27 Hospital disaster preparedness in sub-Saharan Africa: a systematic review of English literature Farah, Bashir Pavlova, Milena Groot, Wim BMC Emerg Med Research BACKGROUND: Disasters are increasing worldwide, with Sub-Saharan Africa (SSA) being one of the most prone regions. Hospitals play a key role in disasters. This study provides a systematic review of the evidence on disaster preparedness by hospitals in SSA countries based on English literature. METHODS: A systematic literature review was conducted of articles published between January 2012 and July 2022. We searched PubMed, Elsevier, Science Direct, Google Scholar, the WHO depository library and CDC sites for English language publications. The key inclusion criteria were: publications should have been published in the above period, deal with hospital disaster preparedness in SSA, the full paper should have been available, and studies should have presented a comparison between hospitals and/or a single hospital. RESULTS: Results indicate improvements in disaster preparedness over time. However, health systems in SSA are generally considered vulnerable, and they find it difficult to adapt to changing health conditions. Inadequately skilled healthcare professionals, underfunding, poor knowledge, the absence of governance and leadership, lack of transparency and bureaucracy are the main preparedness barriers. Some countries are in an infancy stage of their health system development, while others are among the least developed health system in the world. Finally, a major barrier to disaster preparedness in SSA countries is the inability to collaborate in disaster response. CONCLUSIONS: Hospital disaster preparedness is vulnerable in SSA countries. Thus, improvement of hospital disaster preparedness is highly needed. SUPPLEMENTARY INFORMATION: The online version contains supplementary material available at 10.1186/s12873-023-00843-5. BioMed Central 2023-06-26 /pmc/articles/PMC10291806/ /pubmed/37365529 http://dx.doi.org/10.1186/s12873-023-00843-5 Text en © The Author(s) 2023 https://creativecommons.org/licenses/by/4.0/Open Access This article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons licence, and indicate if changes were made. The images or other third party material in this article are included in the article's Creative Commons licence, unless indicated otherwise in a credit line to the material. If material is not included in the article's Creative Commons licence and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this licence, visit http://creativecommons.org/licenses/by/4.0/ (https://creativecommons.org/licenses/by/4.0/) . The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/ (https://creativecommons.org/publicdomain/zero/1.0/) ) applies to the data made available in this article, unless otherwise stated in a credit line to the data. |
spellingShingle | Research Farah, Bashir Pavlova, Milena Groot, Wim Hospital disaster preparedness in sub-Saharan Africa: a systematic review of English literature |
title | Hospital disaster preparedness in sub-Saharan Africa: a systematic review of English literature |
title_full | Hospital disaster preparedness in sub-Saharan Africa: a systematic review of English literature |
title_fullStr | Hospital disaster preparedness in sub-Saharan Africa: a systematic review of English literature |
title_full_unstemmed | Hospital disaster preparedness in sub-Saharan Africa: a systematic review of English literature |
title_short | Hospital disaster preparedness in sub-Saharan Africa: a systematic review of English literature |
title_sort | hospital disaster preparedness in sub-saharan africa: a systematic review of english literature |
topic | Research |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10291806/ https://www.ncbi.nlm.nih.gov/pubmed/37365529 http://dx.doi.org/10.1186/s12873-023-00843-5 |
work_keys_str_mv | AT farahbashir hospitaldisasterpreparednessinsubsaharanafricaasystematicreviewofenglishliterature AT pavlovamilena hospitaldisasterpreparednessinsubsaharanafricaasystematicreviewofenglishliterature AT grootwim hospitaldisasterpreparednessinsubsaharanafricaasystematicreviewofenglishliterature |