Cargando…

Hospital disaster preparedness in sub-Saharan Africa: a systematic review of English literature

BACKGROUND: Disasters are increasing worldwide, with Sub-Saharan Africa (SSA) being one of the most prone regions. Hospitals play a key role in disasters. This study provides a systematic review of the evidence on disaster preparedness by hospitals in SSA countries based on English literature. METHO...

Descripción completa

Detalles Bibliográficos
Autores principales: Farah, Bashir, Pavlova, Milena, Groot, Wim
Formato: Online Artículo Texto
Lenguaje:English
Publicado: BioMed Central 2023
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10291806/
https://www.ncbi.nlm.nih.gov/pubmed/37365529
http://dx.doi.org/10.1186/s12873-023-00843-5
_version_ 1785062759471251456
author Farah, Bashir
Pavlova, Milena
Groot, Wim
author_facet Farah, Bashir
Pavlova, Milena
Groot, Wim
author_sort Farah, Bashir
collection PubMed
description BACKGROUND: Disasters are increasing worldwide, with Sub-Saharan Africa (SSA) being one of the most prone regions. Hospitals play a key role in disasters. This study provides a systematic review of the evidence on disaster preparedness by hospitals in SSA countries based on English literature. METHODS: A systematic literature review was conducted of articles published between January 2012 and July 2022. We searched PubMed, Elsevier, Science Direct, Google Scholar, the WHO depository library and CDC sites for English language publications. The key inclusion criteria were: publications should have been published in the above period, deal with hospital disaster preparedness in SSA, the full paper should have been available, and studies should have presented a comparison between hospitals and/or a single hospital. RESULTS: Results indicate improvements in disaster preparedness over time. However, health systems in SSA are generally considered vulnerable, and they find it difficult to adapt to changing health conditions. Inadequately skilled healthcare professionals, underfunding, poor knowledge, the absence of governance and leadership, lack of transparency and bureaucracy are the main preparedness barriers. Some countries are in an infancy stage of their health system development, while others are among the least developed health system in the world. Finally, a major barrier to disaster preparedness in SSA countries is the inability to collaborate in disaster response. CONCLUSIONS: Hospital disaster preparedness is vulnerable in SSA countries. Thus, improvement of hospital disaster preparedness is highly needed. SUPPLEMENTARY INFORMATION: The online version contains supplementary material available at 10.1186/s12873-023-00843-5.
format Online
Article
Text
id pubmed-10291806
institution National Center for Biotechnology Information
language English
publishDate 2023
publisher BioMed Central
record_format MEDLINE/PubMed
spelling pubmed-102918062023-06-27 Hospital disaster preparedness in sub-Saharan Africa: a systematic review of English literature Farah, Bashir Pavlova, Milena Groot, Wim BMC Emerg Med Research BACKGROUND: Disasters are increasing worldwide, with Sub-Saharan Africa (SSA) being one of the most prone regions. Hospitals play a key role in disasters. This study provides a systematic review of the evidence on disaster preparedness by hospitals in SSA countries based on English literature. METHODS: A systematic literature review was conducted of articles published between January 2012 and July 2022. We searched PubMed, Elsevier, Science Direct, Google Scholar, the WHO depository library and CDC sites for English language publications. The key inclusion criteria were: publications should have been published in the above period, deal with hospital disaster preparedness in SSA, the full paper should have been available, and studies should have presented a comparison between hospitals and/or a single hospital. RESULTS: Results indicate improvements in disaster preparedness over time. However, health systems in SSA are generally considered vulnerable, and they find it difficult to adapt to changing health conditions. Inadequately skilled healthcare professionals, underfunding, poor knowledge, the absence of governance and leadership, lack of transparency and bureaucracy are the main preparedness barriers. Some countries are in an infancy stage of their health system development, while others are among the least developed health system in the world. Finally, a major barrier to disaster preparedness in SSA countries is the inability to collaborate in disaster response. CONCLUSIONS: Hospital disaster preparedness is vulnerable in SSA countries. Thus, improvement of hospital disaster preparedness is highly needed. SUPPLEMENTARY INFORMATION: The online version contains supplementary material available at 10.1186/s12873-023-00843-5. BioMed Central 2023-06-26 /pmc/articles/PMC10291806/ /pubmed/37365529 http://dx.doi.org/10.1186/s12873-023-00843-5 Text en © The Author(s) 2023 https://creativecommons.org/licenses/by/4.0/Open Access This article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons licence, and indicate if changes were made. The images or other third party material in this article are included in the article's Creative Commons licence, unless indicated otherwise in a credit line to the material. If material is not included in the article's Creative Commons licence and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this licence, visit http://creativecommons.org/licenses/by/4.0/ (https://creativecommons.org/licenses/by/4.0/) . The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/ (https://creativecommons.org/publicdomain/zero/1.0/) ) applies to the data made available in this article, unless otherwise stated in a credit line to the data.
spellingShingle Research
Farah, Bashir
Pavlova, Milena
Groot, Wim
Hospital disaster preparedness in sub-Saharan Africa: a systematic review of English literature
title Hospital disaster preparedness in sub-Saharan Africa: a systematic review of English literature
title_full Hospital disaster preparedness in sub-Saharan Africa: a systematic review of English literature
title_fullStr Hospital disaster preparedness in sub-Saharan Africa: a systematic review of English literature
title_full_unstemmed Hospital disaster preparedness in sub-Saharan Africa: a systematic review of English literature
title_short Hospital disaster preparedness in sub-Saharan Africa: a systematic review of English literature
title_sort hospital disaster preparedness in sub-saharan africa: a systematic review of english literature
topic Research
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10291806/
https://www.ncbi.nlm.nih.gov/pubmed/37365529
http://dx.doi.org/10.1186/s12873-023-00843-5
work_keys_str_mv AT farahbashir hospitaldisasterpreparednessinsubsaharanafricaasystematicreviewofenglishliterature
AT pavlovamilena hospitaldisasterpreparednessinsubsaharanafricaasystematicreviewofenglishliterature
AT grootwim hospitaldisasterpreparednessinsubsaharanafricaasystematicreviewofenglishliterature