Cargando…
Changes in the AGE/Macrophage/TNF-α Pathway Affect Skin Dryness during KK-Ay/Tajcl Mice Aging
Skin dryness associated with type 2 diabetes worsens with age; however, the underlying mechanisms remain unclear. Herein, we investigated the effects of aging on skin dryness using a type 2 diabetes mice model. Specific pathogen-free KK-Ay/TaJcl mice of different ages (10, 27, 40, and 50 weeks) were...
Autores principales: | , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
MDPI
2023
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10304917/ https://www.ncbi.nlm.nih.gov/pubmed/37374121 http://dx.doi.org/10.3390/life13061339 |
_version_ | 1785065613009354752 |
---|---|
author | Hiramoto, Keiichi Imai, Masashi Tanaka, Shota Ooi, Kazuya |
author_facet | Hiramoto, Keiichi Imai, Masashi Tanaka, Shota Ooi, Kazuya |
author_sort | Hiramoto, Keiichi |
collection | PubMed |
description | Skin dryness associated with type 2 diabetes worsens with age; however, the underlying mechanisms remain unclear. Herein, we investigated the effects of aging on skin dryness using a type 2 diabetes mice model. Specific pathogen-free KK-Ay/TaJcl mice of different ages (10, 27, 40, and 50 weeks) were used in this study. The results confirmed that skin dryness worsens with age. Furthermore, increased levels of advanced glycation end products (AGE), prostaglandin E2 (PGE2), and tumor necrosis factor (TNF)-α, along with an increased expression of the major AGE receptor (RAGE), an increased macrophage number, and decreased collagen expression were observed in the skin of aged KK-Ay/TaJcl mice. In conclusion, dry skin conditions worsen with age in diabetic mice, and the AGE/RAGE/PGE2 and TNF-α pathways play an important role in exacerbating skin dryness during aging in these mice. |
format | Online Article Text |
id | pubmed-10304917 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2023 |
publisher | MDPI |
record_format | MEDLINE/PubMed |
spelling | pubmed-103049172023-06-29 Changes in the AGE/Macrophage/TNF-α Pathway Affect Skin Dryness during KK-Ay/Tajcl Mice Aging Hiramoto, Keiichi Imai, Masashi Tanaka, Shota Ooi, Kazuya Life (Basel) Communication Skin dryness associated with type 2 diabetes worsens with age; however, the underlying mechanisms remain unclear. Herein, we investigated the effects of aging on skin dryness using a type 2 diabetes mice model. Specific pathogen-free KK-Ay/TaJcl mice of different ages (10, 27, 40, and 50 weeks) were used in this study. The results confirmed that skin dryness worsens with age. Furthermore, increased levels of advanced glycation end products (AGE), prostaglandin E2 (PGE2), and tumor necrosis factor (TNF)-α, along with an increased expression of the major AGE receptor (RAGE), an increased macrophage number, and decreased collagen expression were observed in the skin of aged KK-Ay/TaJcl mice. In conclusion, dry skin conditions worsen with age in diabetic mice, and the AGE/RAGE/PGE2 and TNF-α pathways play an important role in exacerbating skin dryness during aging in these mice. MDPI 2023-06-07 /pmc/articles/PMC10304917/ /pubmed/37374121 http://dx.doi.org/10.3390/life13061339 Text en © 2023 by the authors. https://creativecommons.org/licenses/by/4.0/Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (https://creativecommons.org/licenses/by/4.0/). |
spellingShingle | Communication Hiramoto, Keiichi Imai, Masashi Tanaka, Shota Ooi, Kazuya Changes in the AGE/Macrophage/TNF-α Pathway Affect Skin Dryness during KK-Ay/Tajcl Mice Aging |
title | Changes in the AGE/Macrophage/TNF-α Pathway Affect Skin Dryness during KK-Ay/Tajcl Mice Aging |
title_full | Changes in the AGE/Macrophage/TNF-α Pathway Affect Skin Dryness during KK-Ay/Tajcl Mice Aging |
title_fullStr | Changes in the AGE/Macrophage/TNF-α Pathway Affect Skin Dryness during KK-Ay/Tajcl Mice Aging |
title_full_unstemmed | Changes in the AGE/Macrophage/TNF-α Pathway Affect Skin Dryness during KK-Ay/Tajcl Mice Aging |
title_short | Changes in the AGE/Macrophage/TNF-α Pathway Affect Skin Dryness during KK-Ay/Tajcl Mice Aging |
title_sort | changes in the age/macrophage/tnf-α pathway affect skin dryness during kk-ay/tajcl mice aging |
topic | Communication |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10304917/ https://www.ncbi.nlm.nih.gov/pubmed/37374121 http://dx.doi.org/10.3390/life13061339 |
work_keys_str_mv | AT hiramotokeiichi changesintheagemacrophagetnfapathwayaffectskindrynessduringkkaytajclmiceaging AT imaimasashi changesintheagemacrophagetnfapathwayaffectskindrynessduringkkaytajclmiceaging AT tanakashota changesintheagemacrophagetnfapathwayaffectskindrynessduringkkaytajclmiceaging AT ooikazuya changesintheagemacrophagetnfapathwayaffectskindrynessduringkkaytajclmiceaging |