Cargando…

Changes in the AGE/Macrophage/TNF-α Pathway Affect Skin Dryness during KK-Ay/Tajcl Mice Aging

Skin dryness associated with type 2 diabetes worsens with age; however, the underlying mechanisms remain unclear. Herein, we investigated the effects of aging on skin dryness using a type 2 diabetes mice model. Specific pathogen-free KK-Ay/TaJcl mice of different ages (10, 27, 40, and 50 weeks) were...

Descripción completa

Detalles Bibliográficos
Autores principales: Hiramoto, Keiichi, Imai, Masashi, Tanaka, Shota, Ooi, Kazuya
Formato: Online Artículo Texto
Lenguaje:English
Publicado: MDPI 2023
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10304917/
https://www.ncbi.nlm.nih.gov/pubmed/37374121
http://dx.doi.org/10.3390/life13061339
_version_ 1785065613009354752
author Hiramoto, Keiichi
Imai, Masashi
Tanaka, Shota
Ooi, Kazuya
author_facet Hiramoto, Keiichi
Imai, Masashi
Tanaka, Shota
Ooi, Kazuya
author_sort Hiramoto, Keiichi
collection PubMed
description Skin dryness associated with type 2 diabetes worsens with age; however, the underlying mechanisms remain unclear. Herein, we investigated the effects of aging on skin dryness using a type 2 diabetes mice model. Specific pathogen-free KK-Ay/TaJcl mice of different ages (10, 27, 40, and 50 weeks) were used in this study. The results confirmed that skin dryness worsens with age. Furthermore, increased levels of advanced glycation end products (AGE), prostaglandin E2 (PGE2), and tumor necrosis factor (TNF)-α, along with an increased expression of the major AGE receptor (RAGE), an increased macrophage number, and decreased collagen expression were observed in the skin of aged KK-Ay/TaJcl mice. In conclusion, dry skin conditions worsen with age in diabetic mice, and the AGE/RAGE/PGE2 and TNF-α pathways play an important role in exacerbating skin dryness during aging in these mice.
format Online
Article
Text
id pubmed-10304917
institution National Center for Biotechnology Information
language English
publishDate 2023
publisher MDPI
record_format MEDLINE/PubMed
spelling pubmed-103049172023-06-29 Changes in the AGE/Macrophage/TNF-α Pathway Affect Skin Dryness during KK-Ay/Tajcl Mice Aging Hiramoto, Keiichi Imai, Masashi Tanaka, Shota Ooi, Kazuya Life (Basel) Communication Skin dryness associated with type 2 diabetes worsens with age; however, the underlying mechanisms remain unclear. Herein, we investigated the effects of aging on skin dryness using a type 2 diabetes mice model. Specific pathogen-free KK-Ay/TaJcl mice of different ages (10, 27, 40, and 50 weeks) were used in this study. The results confirmed that skin dryness worsens with age. Furthermore, increased levels of advanced glycation end products (AGE), prostaglandin E2 (PGE2), and tumor necrosis factor (TNF)-α, along with an increased expression of the major AGE receptor (RAGE), an increased macrophage number, and decreased collagen expression were observed in the skin of aged KK-Ay/TaJcl mice. In conclusion, dry skin conditions worsen with age in diabetic mice, and the AGE/RAGE/PGE2 and TNF-α pathways play an important role in exacerbating skin dryness during aging in these mice. MDPI 2023-06-07 /pmc/articles/PMC10304917/ /pubmed/37374121 http://dx.doi.org/10.3390/life13061339 Text en © 2023 by the authors. https://creativecommons.org/licenses/by/4.0/Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (https://creativecommons.org/licenses/by/4.0/).
spellingShingle Communication
Hiramoto, Keiichi
Imai, Masashi
Tanaka, Shota
Ooi, Kazuya
Changes in the AGE/Macrophage/TNF-α Pathway Affect Skin Dryness during KK-Ay/Tajcl Mice Aging
title Changes in the AGE/Macrophage/TNF-α Pathway Affect Skin Dryness during KK-Ay/Tajcl Mice Aging
title_full Changes in the AGE/Macrophage/TNF-α Pathway Affect Skin Dryness during KK-Ay/Tajcl Mice Aging
title_fullStr Changes in the AGE/Macrophage/TNF-α Pathway Affect Skin Dryness during KK-Ay/Tajcl Mice Aging
title_full_unstemmed Changes in the AGE/Macrophage/TNF-α Pathway Affect Skin Dryness during KK-Ay/Tajcl Mice Aging
title_short Changes in the AGE/Macrophage/TNF-α Pathway Affect Skin Dryness during KK-Ay/Tajcl Mice Aging
title_sort changes in the age/macrophage/tnf-α pathway affect skin dryness during kk-ay/tajcl mice aging
topic Communication
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10304917/
https://www.ncbi.nlm.nih.gov/pubmed/37374121
http://dx.doi.org/10.3390/life13061339
work_keys_str_mv AT hiramotokeiichi changesintheagemacrophagetnfapathwayaffectskindrynessduringkkaytajclmiceaging
AT imaimasashi changesintheagemacrophagetnfapathwayaffectskindrynessduringkkaytajclmiceaging
AT tanakashota changesintheagemacrophagetnfapathwayaffectskindrynessduringkkaytajclmiceaging
AT ooikazuya changesintheagemacrophagetnfapathwayaffectskindrynessduringkkaytajclmiceaging