Cargando…
A novel single alpha-helix DNA-binding domain in CAF-1 promotes gene silencing and DNA damage survival through tetrasome-length DNA selectivity and spacer function
The histone chaperone chromatin assembly factor 1 (CAF-1) deposits two nascent histone H3/H4 dimers onto newly replicated DNA forming the central core of the nucleosome known as the tetrasome. How CAF-1 ensures there is sufficient space for the assembly of tetrasomes remains unknown. Structural and...
Autores principales: | , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
eLife Sciences Publications, Ltd
2023
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10335832/ https://www.ncbi.nlm.nih.gov/pubmed/37432722 http://dx.doi.org/10.7554/eLife.83538 |
_version_ | 1785071080202829824 |
---|---|
author | Rosas, Ruben Aguilar, Rhiannon R Arslanovic, Nina Seck, Anna Smith, Duncan J Tyler, Jessica K Churchill, Mair EA |
author_facet | Rosas, Ruben Aguilar, Rhiannon R Arslanovic, Nina Seck, Anna Smith, Duncan J Tyler, Jessica K Churchill, Mair EA |
author_sort | Rosas, Ruben |
collection | PubMed |
description | The histone chaperone chromatin assembly factor 1 (CAF-1) deposits two nascent histone H3/H4 dimers onto newly replicated DNA forming the central core of the nucleosome known as the tetrasome. How CAF-1 ensures there is sufficient space for the assembly of tetrasomes remains unknown. Structural and biophysical characterization of the lysine/glutamic acid/arginine-rich (KER) region of CAF-1 revealed a 128-Å single alpha-helix (SAH) motif with unprecedented DNA-binding properties. Distinct KER sequence features and length of the SAH drive the selectivity of CAF-1 for tetrasome-length DNA and facilitate function in budding yeast. In vivo, the KER cooperates with the DNA-binding winged helix domain in CAF-1 to overcome DNA damage sensitivity and maintain silencing of gene expression. We propose that the KER SAH links functional domains within CAF-1 with structural precision, acting as a DNA-binding spacer element during chromatin assembly. |
format | Online Article Text |
id | pubmed-10335832 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2023 |
publisher | eLife Sciences Publications, Ltd |
record_format | MEDLINE/PubMed |
spelling | pubmed-103358322023-07-12 A novel single alpha-helix DNA-binding domain in CAF-1 promotes gene silencing and DNA damage survival through tetrasome-length DNA selectivity and spacer function Rosas, Ruben Aguilar, Rhiannon R Arslanovic, Nina Seck, Anna Smith, Duncan J Tyler, Jessica K Churchill, Mair EA eLife Chromosomes and Gene Expression The histone chaperone chromatin assembly factor 1 (CAF-1) deposits two nascent histone H3/H4 dimers onto newly replicated DNA forming the central core of the nucleosome known as the tetrasome. How CAF-1 ensures there is sufficient space for the assembly of tetrasomes remains unknown. Structural and biophysical characterization of the lysine/glutamic acid/arginine-rich (KER) region of CAF-1 revealed a 128-Å single alpha-helix (SAH) motif with unprecedented DNA-binding properties. Distinct KER sequence features and length of the SAH drive the selectivity of CAF-1 for tetrasome-length DNA and facilitate function in budding yeast. In vivo, the KER cooperates with the DNA-binding winged helix domain in CAF-1 to overcome DNA damage sensitivity and maintain silencing of gene expression. We propose that the KER SAH links functional domains within CAF-1 with structural precision, acting as a DNA-binding spacer element during chromatin assembly. eLife Sciences Publications, Ltd 2023-07-11 /pmc/articles/PMC10335832/ /pubmed/37432722 http://dx.doi.org/10.7554/eLife.83538 Text en © 2023, Rosas, Aguilar et al https://creativecommons.org/licenses/by/4.0/This article is distributed under the terms of the Creative Commons Attribution License (https://creativecommons.org/licenses/by/4.0/) , which permits unrestricted use and redistribution provided that the original author and source are credited. |
spellingShingle | Chromosomes and Gene Expression Rosas, Ruben Aguilar, Rhiannon R Arslanovic, Nina Seck, Anna Smith, Duncan J Tyler, Jessica K Churchill, Mair EA A novel single alpha-helix DNA-binding domain in CAF-1 promotes gene silencing and DNA damage survival through tetrasome-length DNA selectivity and spacer function |
title | A novel single alpha-helix DNA-binding domain in CAF-1 promotes gene silencing and DNA damage survival through tetrasome-length DNA selectivity and spacer function |
title_full | A novel single alpha-helix DNA-binding domain in CAF-1 promotes gene silencing and DNA damage survival through tetrasome-length DNA selectivity and spacer function |
title_fullStr | A novel single alpha-helix DNA-binding domain in CAF-1 promotes gene silencing and DNA damage survival through tetrasome-length DNA selectivity and spacer function |
title_full_unstemmed | A novel single alpha-helix DNA-binding domain in CAF-1 promotes gene silencing and DNA damage survival through tetrasome-length DNA selectivity and spacer function |
title_short | A novel single alpha-helix DNA-binding domain in CAF-1 promotes gene silencing and DNA damage survival through tetrasome-length DNA selectivity and spacer function |
title_sort | novel single alpha-helix dna-binding domain in caf-1 promotes gene silencing and dna damage survival through tetrasome-length dna selectivity and spacer function |
topic | Chromosomes and Gene Expression |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10335832/ https://www.ncbi.nlm.nih.gov/pubmed/37432722 http://dx.doi.org/10.7554/eLife.83538 |
work_keys_str_mv | AT rosasruben anovelsinglealphahelixdnabindingdomainincaf1promotesgenesilencinganddnadamagesurvivalthroughtetrasomelengthdnaselectivityandspacerfunction AT aguilarrhiannonr anovelsinglealphahelixdnabindingdomainincaf1promotesgenesilencinganddnadamagesurvivalthroughtetrasomelengthdnaselectivityandspacerfunction AT arslanovicnina anovelsinglealphahelixdnabindingdomainincaf1promotesgenesilencinganddnadamagesurvivalthroughtetrasomelengthdnaselectivityandspacerfunction AT seckanna anovelsinglealphahelixdnabindingdomainincaf1promotesgenesilencinganddnadamagesurvivalthroughtetrasomelengthdnaselectivityandspacerfunction AT smithduncanj anovelsinglealphahelixdnabindingdomainincaf1promotesgenesilencinganddnadamagesurvivalthroughtetrasomelengthdnaselectivityandspacerfunction AT tylerjessicak anovelsinglealphahelixdnabindingdomainincaf1promotesgenesilencinganddnadamagesurvivalthroughtetrasomelengthdnaselectivityandspacerfunction AT churchillmairea anovelsinglealphahelixdnabindingdomainincaf1promotesgenesilencinganddnadamagesurvivalthroughtetrasomelengthdnaselectivityandspacerfunction AT rosasruben novelsinglealphahelixdnabindingdomainincaf1promotesgenesilencinganddnadamagesurvivalthroughtetrasomelengthdnaselectivityandspacerfunction AT aguilarrhiannonr novelsinglealphahelixdnabindingdomainincaf1promotesgenesilencinganddnadamagesurvivalthroughtetrasomelengthdnaselectivityandspacerfunction AT arslanovicnina novelsinglealphahelixdnabindingdomainincaf1promotesgenesilencinganddnadamagesurvivalthroughtetrasomelengthdnaselectivityandspacerfunction AT seckanna novelsinglealphahelixdnabindingdomainincaf1promotesgenesilencinganddnadamagesurvivalthroughtetrasomelengthdnaselectivityandspacerfunction AT smithduncanj novelsinglealphahelixdnabindingdomainincaf1promotesgenesilencinganddnadamagesurvivalthroughtetrasomelengthdnaselectivityandspacerfunction AT tylerjessicak novelsinglealphahelixdnabindingdomainincaf1promotesgenesilencinganddnadamagesurvivalthroughtetrasomelengthdnaselectivityandspacerfunction AT churchillmairea novelsinglealphahelixdnabindingdomainincaf1promotesgenesilencinganddnadamagesurvivalthroughtetrasomelengthdnaselectivityandspacerfunction |