Cargando…

A novel single alpha-helix DNA-binding domain in CAF-1 promotes gene silencing and DNA damage survival through tetrasome-length DNA selectivity and spacer function

The histone chaperone chromatin assembly factor 1 (CAF-1) deposits two nascent histone H3/H4 dimers onto newly replicated DNA forming the central core of the nucleosome known as the tetrasome. How CAF-1 ensures there is sufficient space for the assembly of tetrasomes remains unknown. Structural and...

Descripción completa

Detalles Bibliográficos
Autores principales: Rosas, Ruben, Aguilar, Rhiannon R, Arslanovic, Nina, Seck, Anna, Smith, Duncan J, Tyler, Jessica K, Churchill, Mair EA
Formato: Online Artículo Texto
Lenguaje:English
Publicado: eLife Sciences Publications, Ltd 2023
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10335832/
https://www.ncbi.nlm.nih.gov/pubmed/37432722
http://dx.doi.org/10.7554/eLife.83538
_version_ 1785071080202829824
author Rosas, Ruben
Aguilar, Rhiannon R
Arslanovic, Nina
Seck, Anna
Smith, Duncan J
Tyler, Jessica K
Churchill, Mair EA
author_facet Rosas, Ruben
Aguilar, Rhiannon R
Arslanovic, Nina
Seck, Anna
Smith, Duncan J
Tyler, Jessica K
Churchill, Mair EA
author_sort Rosas, Ruben
collection PubMed
description The histone chaperone chromatin assembly factor 1 (CAF-1) deposits two nascent histone H3/H4 dimers onto newly replicated DNA forming the central core of the nucleosome known as the tetrasome. How CAF-1 ensures there is sufficient space for the assembly of tetrasomes remains unknown. Structural and biophysical characterization of the lysine/glutamic acid/arginine-rich (KER) region of CAF-1 revealed a 128-Å single alpha-helix (SAH) motif with unprecedented DNA-binding properties. Distinct KER sequence features and length of the SAH drive the selectivity of CAF-1 for tetrasome-length DNA and facilitate function in budding yeast. In vivo, the KER cooperates with the DNA-binding winged helix domain in CAF-1 to overcome DNA damage sensitivity and maintain silencing of gene expression. We propose that the KER SAH links functional domains within CAF-1 with structural precision, acting as a DNA-binding spacer element during chromatin assembly.
format Online
Article
Text
id pubmed-10335832
institution National Center for Biotechnology Information
language English
publishDate 2023
publisher eLife Sciences Publications, Ltd
record_format MEDLINE/PubMed
spelling pubmed-103358322023-07-12 A novel single alpha-helix DNA-binding domain in CAF-1 promotes gene silencing and DNA damage survival through tetrasome-length DNA selectivity and spacer function Rosas, Ruben Aguilar, Rhiannon R Arslanovic, Nina Seck, Anna Smith, Duncan J Tyler, Jessica K Churchill, Mair EA eLife Chromosomes and Gene Expression The histone chaperone chromatin assembly factor 1 (CAF-1) deposits two nascent histone H3/H4 dimers onto newly replicated DNA forming the central core of the nucleosome known as the tetrasome. How CAF-1 ensures there is sufficient space for the assembly of tetrasomes remains unknown. Structural and biophysical characterization of the lysine/glutamic acid/arginine-rich (KER) region of CAF-1 revealed a 128-Å single alpha-helix (SAH) motif with unprecedented DNA-binding properties. Distinct KER sequence features and length of the SAH drive the selectivity of CAF-1 for tetrasome-length DNA and facilitate function in budding yeast. In vivo, the KER cooperates with the DNA-binding winged helix domain in CAF-1 to overcome DNA damage sensitivity and maintain silencing of gene expression. We propose that the KER SAH links functional domains within CAF-1 with structural precision, acting as a DNA-binding spacer element during chromatin assembly. eLife Sciences Publications, Ltd 2023-07-11 /pmc/articles/PMC10335832/ /pubmed/37432722 http://dx.doi.org/10.7554/eLife.83538 Text en © 2023, Rosas, Aguilar et al https://creativecommons.org/licenses/by/4.0/This article is distributed under the terms of the Creative Commons Attribution License (https://creativecommons.org/licenses/by/4.0/) , which permits unrestricted use and redistribution provided that the original author and source are credited.
spellingShingle Chromosomes and Gene Expression
Rosas, Ruben
Aguilar, Rhiannon R
Arslanovic, Nina
Seck, Anna
Smith, Duncan J
Tyler, Jessica K
Churchill, Mair EA
A novel single alpha-helix DNA-binding domain in CAF-1 promotes gene silencing and DNA damage survival through tetrasome-length DNA selectivity and spacer function
title A novel single alpha-helix DNA-binding domain in CAF-1 promotes gene silencing and DNA damage survival through tetrasome-length DNA selectivity and spacer function
title_full A novel single alpha-helix DNA-binding domain in CAF-1 promotes gene silencing and DNA damage survival through tetrasome-length DNA selectivity and spacer function
title_fullStr A novel single alpha-helix DNA-binding domain in CAF-1 promotes gene silencing and DNA damage survival through tetrasome-length DNA selectivity and spacer function
title_full_unstemmed A novel single alpha-helix DNA-binding domain in CAF-1 promotes gene silencing and DNA damage survival through tetrasome-length DNA selectivity and spacer function
title_short A novel single alpha-helix DNA-binding domain in CAF-1 promotes gene silencing and DNA damage survival through tetrasome-length DNA selectivity and spacer function
title_sort novel single alpha-helix dna-binding domain in caf-1 promotes gene silencing and dna damage survival through tetrasome-length dna selectivity and spacer function
topic Chromosomes and Gene Expression
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10335832/
https://www.ncbi.nlm.nih.gov/pubmed/37432722
http://dx.doi.org/10.7554/eLife.83538
work_keys_str_mv AT rosasruben anovelsinglealphahelixdnabindingdomainincaf1promotesgenesilencinganddnadamagesurvivalthroughtetrasomelengthdnaselectivityandspacerfunction
AT aguilarrhiannonr anovelsinglealphahelixdnabindingdomainincaf1promotesgenesilencinganddnadamagesurvivalthroughtetrasomelengthdnaselectivityandspacerfunction
AT arslanovicnina anovelsinglealphahelixdnabindingdomainincaf1promotesgenesilencinganddnadamagesurvivalthroughtetrasomelengthdnaselectivityandspacerfunction
AT seckanna anovelsinglealphahelixdnabindingdomainincaf1promotesgenesilencinganddnadamagesurvivalthroughtetrasomelengthdnaselectivityandspacerfunction
AT smithduncanj anovelsinglealphahelixdnabindingdomainincaf1promotesgenesilencinganddnadamagesurvivalthroughtetrasomelengthdnaselectivityandspacerfunction
AT tylerjessicak anovelsinglealphahelixdnabindingdomainincaf1promotesgenesilencinganddnadamagesurvivalthroughtetrasomelengthdnaselectivityandspacerfunction
AT churchillmairea anovelsinglealphahelixdnabindingdomainincaf1promotesgenesilencinganddnadamagesurvivalthroughtetrasomelengthdnaselectivityandspacerfunction
AT rosasruben novelsinglealphahelixdnabindingdomainincaf1promotesgenesilencinganddnadamagesurvivalthroughtetrasomelengthdnaselectivityandspacerfunction
AT aguilarrhiannonr novelsinglealphahelixdnabindingdomainincaf1promotesgenesilencinganddnadamagesurvivalthroughtetrasomelengthdnaselectivityandspacerfunction
AT arslanovicnina novelsinglealphahelixdnabindingdomainincaf1promotesgenesilencinganddnadamagesurvivalthroughtetrasomelengthdnaselectivityandspacerfunction
AT seckanna novelsinglealphahelixdnabindingdomainincaf1promotesgenesilencinganddnadamagesurvivalthroughtetrasomelengthdnaselectivityandspacerfunction
AT smithduncanj novelsinglealphahelixdnabindingdomainincaf1promotesgenesilencinganddnadamagesurvivalthroughtetrasomelengthdnaselectivityandspacerfunction
AT tylerjessicak novelsinglealphahelixdnabindingdomainincaf1promotesgenesilencinganddnadamagesurvivalthroughtetrasomelengthdnaselectivityandspacerfunction
AT churchillmairea novelsinglealphahelixdnabindingdomainincaf1promotesgenesilencinganddnadamagesurvivalthroughtetrasomelengthdnaselectivityandspacerfunction