Cargando…

Experimental renal transplantation in rats improves cardiac dysfunction caused by chronic kidney disease while LVH persists

BACKGROUND: Chronic kidney disease (CKD) causes congestive heart failure (CHF) with systolic dysfunction and left ventricular hypertrophy (LVH), which is a major contributor to increased mortality in CKD patients. It remains unclear whether cardiovascular changes that occur during the course of CKD...

Descripción completa

Detalles Bibliográficos
Autores principales: Hagmayer, Linda, Mayer, Christina, Ebert, Nadja, Amann, Kerstin, Daniel, Christoph
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Frontiers Media S.A. 2023
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10340545/
https://www.ncbi.nlm.nih.gov/pubmed/37456824
http://dx.doi.org/10.3389/fcvm.2023.1200323
_version_ 1785072104952037376
author Hagmayer, Linda
Mayer, Christina
Ebert, Nadja
Amann, Kerstin
Daniel, Christoph
author_facet Hagmayer, Linda
Mayer, Christina
Ebert, Nadja
Amann, Kerstin
Daniel, Christoph
author_sort Hagmayer, Linda
collection PubMed
description BACKGROUND: Chronic kidney disease (CKD) causes congestive heart failure (CHF) with systolic dysfunction and left ventricular hypertrophy (LVH), which is a major contributor to increased mortality in CKD patients. It remains unclear whether cardiovascular changes that occur during the course of CKD can be reversed when renal function is restored by transplantation. METHODS: To investigate this, chronic kidney disease was established in F344 rats by subtotal nephrectomy (SNx) for 8 weeks, followed by transplantation of a functional kidney from an isogenic F344 donor. SNx rats without transplantation and sham-operated animals served as controls. Renal function was assessed before and throughout the experiment. In addition, cardiac ultrasound was performed at weeks 0, 8, 12 and 16. At the end of the experiment, intra-arterial blood pressure was measured and kidneys and hearts were histologically and molecularly examined. RESULTS: Eight weeks after SNx, rats developed marked renal dysfunction associated with significant glomerulosclerosis and tubulointerstitial fibrosis, but also an increase in left ventricular mass. After transplantation, renal function normalized but relative heart weight and ventricular mass as assessed by ultrasound scans showed no reduction compared with SNx controls. However, left ventricular wall thickness, fractional shortening and ejection fraction was normalized by renal transplantation. At 8 weeks after kidney transplantation, cardiac expression of BNP and FGF23 was also at levels comparable to healthy controls, whereas these factors were significantly increased in SNx rats. Cardiac fibrosis, as measured by fibronectin mRNA expression, was completely normalized, whereas cardiac fibronectin protein was still slightly but not significantly increased in transplanted animals compared to controls. In addition, the myofibroblast marker collagen 1, as assessed by immunohistochemistry, was significantly increased in SNx rats and also normalized by renal transplantation. Interestingly, CD68+ macrophages were significantly reduced in the hearts of SNx rats and in transplanted animals at slightly higher levels compared to controls. CONCLUSION: Restoration of renal function by kidney transplantation normalized early cardiac changes at most functional and molecular levels, but did not completely reverse LVH. However, further studies are needed to determine whether restoration of renal function can also reverse LVH at a later time point.
format Online
Article
Text
id pubmed-10340545
institution National Center for Biotechnology Information
language English
publishDate 2023
publisher Frontiers Media S.A.
record_format MEDLINE/PubMed
spelling pubmed-103405452023-07-14 Experimental renal transplantation in rats improves cardiac dysfunction caused by chronic kidney disease while LVH persists Hagmayer, Linda Mayer, Christina Ebert, Nadja Amann, Kerstin Daniel, Christoph Front Cardiovasc Med Cardiovascular Medicine BACKGROUND: Chronic kidney disease (CKD) causes congestive heart failure (CHF) with systolic dysfunction and left ventricular hypertrophy (LVH), which is a major contributor to increased mortality in CKD patients. It remains unclear whether cardiovascular changes that occur during the course of CKD can be reversed when renal function is restored by transplantation. METHODS: To investigate this, chronic kidney disease was established in F344 rats by subtotal nephrectomy (SNx) for 8 weeks, followed by transplantation of a functional kidney from an isogenic F344 donor. SNx rats without transplantation and sham-operated animals served as controls. Renal function was assessed before and throughout the experiment. In addition, cardiac ultrasound was performed at weeks 0, 8, 12 and 16. At the end of the experiment, intra-arterial blood pressure was measured and kidneys and hearts were histologically and molecularly examined. RESULTS: Eight weeks after SNx, rats developed marked renal dysfunction associated with significant glomerulosclerosis and tubulointerstitial fibrosis, but also an increase in left ventricular mass. After transplantation, renal function normalized but relative heart weight and ventricular mass as assessed by ultrasound scans showed no reduction compared with SNx controls. However, left ventricular wall thickness, fractional shortening and ejection fraction was normalized by renal transplantation. At 8 weeks after kidney transplantation, cardiac expression of BNP and FGF23 was also at levels comparable to healthy controls, whereas these factors were significantly increased in SNx rats. Cardiac fibrosis, as measured by fibronectin mRNA expression, was completely normalized, whereas cardiac fibronectin protein was still slightly but not significantly increased in transplanted animals compared to controls. In addition, the myofibroblast marker collagen 1, as assessed by immunohistochemistry, was significantly increased in SNx rats and also normalized by renal transplantation. Interestingly, CD68+ macrophages were significantly reduced in the hearts of SNx rats and in transplanted animals at slightly higher levels compared to controls. CONCLUSION: Restoration of renal function by kidney transplantation normalized early cardiac changes at most functional and molecular levels, but did not completely reverse LVH. However, further studies are needed to determine whether restoration of renal function can also reverse LVH at a later time point. Frontiers Media S.A. 2023-06-29 /pmc/articles/PMC10340545/ /pubmed/37456824 http://dx.doi.org/10.3389/fcvm.2023.1200323 Text en © 2023 Hagmayer, Mayer, Ebert, Amann and Daniel. https://creativecommons.org/licenses/by/4.0/This is an open-access article distributed under the terms of the Creative Commons Attribution License (CC BY) (https://creativecommons.org/licenses/by/4.0/) . The use, distribution or reproduction in other forums is permitted, provided the original author(s) and the copyright owner(s) are credited and that the original publication in this journal is cited, in accordance with accepted academic practice. No use, distribution or reproduction is permitted which does not comply with these terms.
spellingShingle Cardiovascular Medicine
Hagmayer, Linda
Mayer, Christina
Ebert, Nadja
Amann, Kerstin
Daniel, Christoph
Experimental renal transplantation in rats improves cardiac dysfunction caused by chronic kidney disease while LVH persists
title Experimental renal transplantation in rats improves cardiac dysfunction caused by chronic kidney disease while LVH persists
title_full Experimental renal transplantation in rats improves cardiac dysfunction caused by chronic kidney disease while LVH persists
title_fullStr Experimental renal transplantation in rats improves cardiac dysfunction caused by chronic kidney disease while LVH persists
title_full_unstemmed Experimental renal transplantation in rats improves cardiac dysfunction caused by chronic kidney disease while LVH persists
title_short Experimental renal transplantation in rats improves cardiac dysfunction caused by chronic kidney disease while LVH persists
title_sort experimental renal transplantation in rats improves cardiac dysfunction caused by chronic kidney disease while lvh persists
topic Cardiovascular Medicine
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10340545/
https://www.ncbi.nlm.nih.gov/pubmed/37456824
http://dx.doi.org/10.3389/fcvm.2023.1200323
work_keys_str_mv AT hagmayerlinda experimentalrenaltransplantationinratsimprovescardiacdysfunctioncausedbychronickidneydiseasewhilelvhpersists
AT mayerchristina experimentalrenaltransplantationinratsimprovescardiacdysfunctioncausedbychronickidneydiseasewhilelvhpersists
AT ebertnadja experimentalrenaltransplantationinratsimprovescardiacdysfunctioncausedbychronickidneydiseasewhilelvhpersists
AT amannkerstin experimentalrenaltransplantationinratsimprovescardiacdysfunctioncausedbychronickidneydiseasewhilelvhpersists
AT danielchristoph experimentalrenaltransplantationinratsimprovescardiacdysfunctioncausedbychronickidneydiseasewhilelvhpersists