Cargando…

Stealth Liposomes Encapsulating a Potent ACAT1/SOAT1 Inhibitor F12511: Pharmacokinetic, Biodistribution, and Toxicity Studies in Wild-Type Mice and Efficacy Studies in Triple Transgenic Alzheimer’s Disease Mice

Cholesterol is essential for cellular function and is stored as cholesteryl esters (CEs). CEs biosynthesis is catalyzed by the enzymes acyl-CoA:cholesterol acyltransferase 1 and 2 (ACAT1 and ACAT2), with ACAT1 being the primary isoenzyme in most cells in humans. In Alzheimer’s Disease, CEs accumulat...

Descripción completa

Detalles Bibliográficos
Autores principales: De La Torre, Adrianna L., Huynh, Thao N., Chang, Catherine C. Y., Pooler, Darcy B., Ness, Dylan B., Lewis, Lionel D., Pannem, Sanjana, Feng, Yichen, Samkoe, Kimberley S., Hickey, William F., Chang, Ta Yuan
Formato: Online Artículo Texto
Lenguaje:English
Publicado: MDPI 2023
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10341764/
https://www.ncbi.nlm.nih.gov/pubmed/37446191
http://dx.doi.org/10.3390/ijms241311013
_version_ 1785072339474448384
author De La Torre, Adrianna L.
Huynh, Thao N.
Chang, Catherine C. Y.
Pooler, Darcy B.
Ness, Dylan B.
Lewis, Lionel D.
Pannem, Sanjana
Feng, Yichen
Samkoe, Kimberley S.
Hickey, William F.
Chang, Ta Yuan
author_facet De La Torre, Adrianna L.
Huynh, Thao N.
Chang, Catherine C. Y.
Pooler, Darcy B.
Ness, Dylan B.
Lewis, Lionel D.
Pannem, Sanjana
Feng, Yichen
Samkoe, Kimberley S.
Hickey, William F.
Chang, Ta Yuan
author_sort De La Torre, Adrianna L.
collection PubMed
description Cholesterol is essential for cellular function and is stored as cholesteryl esters (CEs). CEs biosynthesis is catalyzed by the enzymes acyl-CoA:cholesterol acyltransferase 1 and 2 (ACAT1 and ACAT2), with ACAT1 being the primary isoenzyme in most cells in humans. In Alzheimer’s Disease, CEs accumulate in vulnerable brain regions. Therefore, ACATs may be promising targets for treating AD. F12511 is a high-affinity ACAT1 inhibitor that has passed phase 1 safety tests for antiatherosclerosis. Previously, we developed a nanoparticle system to encapsulate a large concentration of F12511 into a stealth liposome (DSPE-PEG(2000) with phosphatidylcholine). Here, we injected the nanoparticle encapsulated F12511 (nanoparticle F) intravenously (IV) in wild-type mice and performed an HPLC/MS/MS analysis and ACAT enzyme activity measurement. The results demonstrated that F12511 was present within the mouse brain after a single IV but did not overaccumulate in the brain or other tissues after repeated IVs. A histological examination showed that F12511 did not cause overt neurological or systemic toxicity. We then showed that a 2-week IV delivery of nanoparticle F to aging 3xTg AD mice ameliorated amyloidopathy, reduced hyperphosphorylated tau and nonphosphorylated tau, and reduced neuroinflammation. This work lays the foundation for nanoparticle F to be used as a possible therapy for AD and other neurodegenerative diseases.
format Online
Article
Text
id pubmed-10341764
institution National Center for Biotechnology Information
language English
publishDate 2023
publisher MDPI
record_format MEDLINE/PubMed
spelling pubmed-103417642023-07-14 Stealth Liposomes Encapsulating a Potent ACAT1/SOAT1 Inhibitor F12511: Pharmacokinetic, Biodistribution, and Toxicity Studies in Wild-Type Mice and Efficacy Studies in Triple Transgenic Alzheimer’s Disease Mice De La Torre, Adrianna L. Huynh, Thao N. Chang, Catherine C. Y. Pooler, Darcy B. Ness, Dylan B. Lewis, Lionel D. Pannem, Sanjana Feng, Yichen Samkoe, Kimberley S. Hickey, William F. Chang, Ta Yuan Int J Mol Sci Article Cholesterol is essential for cellular function and is stored as cholesteryl esters (CEs). CEs biosynthesis is catalyzed by the enzymes acyl-CoA:cholesterol acyltransferase 1 and 2 (ACAT1 and ACAT2), with ACAT1 being the primary isoenzyme in most cells in humans. In Alzheimer’s Disease, CEs accumulate in vulnerable brain regions. Therefore, ACATs may be promising targets for treating AD. F12511 is a high-affinity ACAT1 inhibitor that has passed phase 1 safety tests for antiatherosclerosis. Previously, we developed a nanoparticle system to encapsulate a large concentration of F12511 into a stealth liposome (DSPE-PEG(2000) with phosphatidylcholine). Here, we injected the nanoparticle encapsulated F12511 (nanoparticle F) intravenously (IV) in wild-type mice and performed an HPLC/MS/MS analysis and ACAT enzyme activity measurement. The results demonstrated that F12511 was present within the mouse brain after a single IV but did not overaccumulate in the brain or other tissues after repeated IVs. A histological examination showed that F12511 did not cause overt neurological or systemic toxicity. We then showed that a 2-week IV delivery of nanoparticle F to aging 3xTg AD mice ameliorated amyloidopathy, reduced hyperphosphorylated tau and nonphosphorylated tau, and reduced neuroinflammation. This work lays the foundation for nanoparticle F to be used as a possible therapy for AD and other neurodegenerative diseases. MDPI 2023-07-02 /pmc/articles/PMC10341764/ /pubmed/37446191 http://dx.doi.org/10.3390/ijms241311013 Text en © 2023 by the authors. https://creativecommons.org/licenses/by/4.0/Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (https://creativecommons.org/licenses/by/4.0/).
spellingShingle Article
De La Torre, Adrianna L.
Huynh, Thao N.
Chang, Catherine C. Y.
Pooler, Darcy B.
Ness, Dylan B.
Lewis, Lionel D.
Pannem, Sanjana
Feng, Yichen
Samkoe, Kimberley S.
Hickey, William F.
Chang, Ta Yuan
Stealth Liposomes Encapsulating a Potent ACAT1/SOAT1 Inhibitor F12511: Pharmacokinetic, Biodistribution, and Toxicity Studies in Wild-Type Mice and Efficacy Studies in Triple Transgenic Alzheimer’s Disease Mice
title Stealth Liposomes Encapsulating a Potent ACAT1/SOAT1 Inhibitor F12511: Pharmacokinetic, Biodistribution, and Toxicity Studies in Wild-Type Mice and Efficacy Studies in Triple Transgenic Alzheimer’s Disease Mice
title_full Stealth Liposomes Encapsulating a Potent ACAT1/SOAT1 Inhibitor F12511: Pharmacokinetic, Biodistribution, and Toxicity Studies in Wild-Type Mice and Efficacy Studies in Triple Transgenic Alzheimer’s Disease Mice
title_fullStr Stealth Liposomes Encapsulating a Potent ACAT1/SOAT1 Inhibitor F12511: Pharmacokinetic, Biodistribution, and Toxicity Studies in Wild-Type Mice and Efficacy Studies in Triple Transgenic Alzheimer’s Disease Mice
title_full_unstemmed Stealth Liposomes Encapsulating a Potent ACAT1/SOAT1 Inhibitor F12511: Pharmacokinetic, Biodistribution, and Toxicity Studies in Wild-Type Mice and Efficacy Studies in Triple Transgenic Alzheimer’s Disease Mice
title_short Stealth Liposomes Encapsulating a Potent ACAT1/SOAT1 Inhibitor F12511: Pharmacokinetic, Biodistribution, and Toxicity Studies in Wild-Type Mice and Efficacy Studies in Triple Transgenic Alzheimer’s Disease Mice
title_sort stealth liposomes encapsulating a potent acat1/soat1 inhibitor f12511: pharmacokinetic, biodistribution, and toxicity studies in wild-type mice and efficacy studies in triple transgenic alzheimer’s disease mice
topic Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10341764/
https://www.ncbi.nlm.nih.gov/pubmed/37446191
http://dx.doi.org/10.3390/ijms241311013
work_keys_str_mv AT delatorreadriannal stealthliposomesencapsulatingapotentacat1soat1inhibitorf12511pharmacokineticbiodistributionandtoxicitystudiesinwildtypemiceandefficacystudiesintripletransgenicalzheimersdiseasemice
AT huynhthaon stealthliposomesencapsulatingapotentacat1soat1inhibitorf12511pharmacokineticbiodistributionandtoxicitystudiesinwildtypemiceandefficacystudiesintripletransgenicalzheimersdiseasemice
AT changcatherinecy stealthliposomesencapsulatingapotentacat1soat1inhibitorf12511pharmacokineticbiodistributionandtoxicitystudiesinwildtypemiceandefficacystudiesintripletransgenicalzheimersdiseasemice
AT poolerdarcyb stealthliposomesencapsulatingapotentacat1soat1inhibitorf12511pharmacokineticbiodistributionandtoxicitystudiesinwildtypemiceandefficacystudiesintripletransgenicalzheimersdiseasemice
AT nessdylanb stealthliposomesencapsulatingapotentacat1soat1inhibitorf12511pharmacokineticbiodistributionandtoxicitystudiesinwildtypemiceandefficacystudiesintripletransgenicalzheimersdiseasemice
AT lewislioneld stealthliposomesencapsulatingapotentacat1soat1inhibitorf12511pharmacokineticbiodistributionandtoxicitystudiesinwildtypemiceandefficacystudiesintripletransgenicalzheimersdiseasemice
AT pannemsanjana stealthliposomesencapsulatingapotentacat1soat1inhibitorf12511pharmacokineticbiodistributionandtoxicitystudiesinwildtypemiceandefficacystudiesintripletransgenicalzheimersdiseasemice
AT fengyichen stealthliposomesencapsulatingapotentacat1soat1inhibitorf12511pharmacokineticbiodistributionandtoxicitystudiesinwildtypemiceandefficacystudiesintripletransgenicalzheimersdiseasemice
AT samkoekimberleys stealthliposomesencapsulatingapotentacat1soat1inhibitorf12511pharmacokineticbiodistributionandtoxicitystudiesinwildtypemiceandefficacystudiesintripletransgenicalzheimersdiseasemice
AT hickeywilliamf stealthliposomesencapsulatingapotentacat1soat1inhibitorf12511pharmacokineticbiodistributionandtoxicitystudiesinwildtypemiceandefficacystudiesintripletransgenicalzheimersdiseasemice
AT changtayuan stealthliposomesencapsulatingapotentacat1soat1inhibitorf12511pharmacokineticbiodistributionandtoxicitystudiesinwildtypemiceandefficacystudiesintripletransgenicalzheimersdiseasemice