Cargando…
Stealth Liposomes Encapsulating a Potent ACAT1/SOAT1 Inhibitor F12511: Pharmacokinetic, Biodistribution, and Toxicity Studies in Wild-Type Mice and Efficacy Studies in Triple Transgenic Alzheimer’s Disease Mice
Cholesterol is essential for cellular function and is stored as cholesteryl esters (CEs). CEs biosynthesis is catalyzed by the enzymes acyl-CoA:cholesterol acyltransferase 1 and 2 (ACAT1 and ACAT2), with ACAT1 being the primary isoenzyme in most cells in humans. In Alzheimer’s Disease, CEs accumulat...
Autores principales: | , , , , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
MDPI
2023
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10341764/ https://www.ncbi.nlm.nih.gov/pubmed/37446191 http://dx.doi.org/10.3390/ijms241311013 |
_version_ | 1785072339474448384 |
---|---|
author | De La Torre, Adrianna L. Huynh, Thao N. Chang, Catherine C. Y. Pooler, Darcy B. Ness, Dylan B. Lewis, Lionel D. Pannem, Sanjana Feng, Yichen Samkoe, Kimberley S. Hickey, William F. Chang, Ta Yuan |
author_facet | De La Torre, Adrianna L. Huynh, Thao N. Chang, Catherine C. Y. Pooler, Darcy B. Ness, Dylan B. Lewis, Lionel D. Pannem, Sanjana Feng, Yichen Samkoe, Kimberley S. Hickey, William F. Chang, Ta Yuan |
author_sort | De La Torre, Adrianna L. |
collection | PubMed |
description | Cholesterol is essential for cellular function and is stored as cholesteryl esters (CEs). CEs biosynthesis is catalyzed by the enzymes acyl-CoA:cholesterol acyltransferase 1 and 2 (ACAT1 and ACAT2), with ACAT1 being the primary isoenzyme in most cells in humans. In Alzheimer’s Disease, CEs accumulate in vulnerable brain regions. Therefore, ACATs may be promising targets for treating AD. F12511 is a high-affinity ACAT1 inhibitor that has passed phase 1 safety tests for antiatherosclerosis. Previously, we developed a nanoparticle system to encapsulate a large concentration of F12511 into a stealth liposome (DSPE-PEG(2000) with phosphatidylcholine). Here, we injected the nanoparticle encapsulated F12511 (nanoparticle F) intravenously (IV) in wild-type mice and performed an HPLC/MS/MS analysis and ACAT enzyme activity measurement. The results demonstrated that F12511 was present within the mouse brain after a single IV but did not overaccumulate in the brain or other tissues after repeated IVs. A histological examination showed that F12511 did not cause overt neurological or systemic toxicity. We then showed that a 2-week IV delivery of nanoparticle F to aging 3xTg AD mice ameliorated amyloidopathy, reduced hyperphosphorylated tau and nonphosphorylated tau, and reduced neuroinflammation. This work lays the foundation for nanoparticle F to be used as a possible therapy for AD and other neurodegenerative diseases. |
format | Online Article Text |
id | pubmed-10341764 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2023 |
publisher | MDPI |
record_format | MEDLINE/PubMed |
spelling | pubmed-103417642023-07-14 Stealth Liposomes Encapsulating a Potent ACAT1/SOAT1 Inhibitor F12511: Pharmacokinetic, Biodistribution, and Toxicity Studies in Wild-Type Mice and Efficacy Studies in Triple Transgenic Alzheimer’s Disease Mice De La Torre, Adrianna L. Huynh, Thao N. Chang, Catherine C. Y. Pooler, Darcy B. Ness, Dylan B. Lewis, Lionel D. Pannem, Sanjana Feng, Yichen Samkoe, Kimberley S. Hickey, William F. Chang, Ta Yuan Int J Mol Sci Article Cholesterol is essential for cellular function and is stored as cholesteryl esters (CEs). CEs biosynthesis is catalyzed by the enzymes acyl-CoA:cholesterol acyltransferase 1 and 2 (ACAT1 and ACAT2), with ACAT1 being the primary isoenzyme in most cells in humans. In Alzheimer’s Disease, CEs accumulate in vulnerable brain regions. Therefore, ACATs may be promising targets for treating AD. F12511 is a high-affinity ACAT1 inhibitor that has passed phase 1 safety tests for antiatherosclerosis. Previously, we developed a nanoparticle system to encapsulate a large concentration of F12511 into a stealth liposome (DSPE-PEG(2000) with phosphatidylcholine). Here, we injected the nanoparticle encapsulated F12511 (nanoparticle F) intravenously (IV) in wild-type mice and performed an HPLC/MS/MS analysis and ACAT enzyme activity measurement. The results demonstrated that F12511 was present within the mouse brain after a single IV but did not overaccumulate in the brain or other tissues after repeated IVs. A histological examination showed that F12511 did not cause overt neurological or systemic toxicity. We then showed that a 2-week IV delivery of nanoparticle F to aging 3xTg AD mice ameliorated amyloidopathy, reduced hyperphosphorylated tau and nonphosphorylated tau, and reduced neuroinflammation. This work lays the foundation for nanoparticle F to be used as a possible therapy for AD and other neurodegenerative diseases. MDPI 2023-07-02 /pmc/articles/PMC10341764/ /pubmed/37446191 http://dx.doi.org/10.3390/ijms241311013 Text en © 2023 by the authors. https://creativecommons.org/licenses/by/4.0/Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (https://creativecommons.org/licenses/by/4.0/). |
spellingShingle | Article De La Torre, Adrianna L. Huynh, Thao N. Chang, Catherine C. Y. Pooler, Darcy B. Ness, Dylan B. Lewis, Lionel D. Pannem, Sanjana Feng, Yichen Samkoe, Kimberley S. Hickey, William F. Chang, Ta Yuan Stealth Liposomes Encapsulating a Potent ACAT1/SOAT1 Inhibitor F12511: Pharmacokinetic, Biodistribution, and Toxicity Studies in Wild-Type Mice and Efficacy Studies in Triple Transgenic Alzheimer’s Disease Mice |
title | Stealth Liposomes Encapsulating a Potent ACAT1/SOAT1 Inhibitor F12511: Pharmacokinetic, Biodistribution, and Toxicity Studies in Wild-Type Mice and Efficacy Studies in Triple Transgenic Alzheimer’s Disease Mice |
title_full | Stealth Liposomes Encapsulating a Potent ACAT1/SOAT1 Inhibitor F12511: Pharmacokinetic, Biodistribution, and Toxicity Studies in Wild-Type Mice and Efficacy Studies in Triple Transgenic Alzheimer’s Disease Mice |
title_fullStr | Stealth Liposomes Encapsulating a Potent ACAT1/SOAT1 Inhibitor F12511: Pharmacokinetic, Biodistribution, and Toxicity Studies in Wild-Type Mice and Efficacy Studies in Triple Transgenic Alzheimer’s Disease Mice |
title_full_unstemmed | Stealth Liposomes Encapsulating a Potent ACAT1/SOAT1 Inhibitor F12511: Pharmacokinetic, Biodistribution, and Toxicity Studies in Wild-Type Mice and Efficacy Studies in Triple Transgenic Alzheimer’s Disease Mice |
title_short | Stealth Liposomes Encapsulating a Potent ACAT1/SOAT1 Inhibitor F12511: Pharmacokinetic, Biodistribution, and Toxicity Studies in Wild-Type Mice and Efficacy Studies in Triple Transgenic Alzheimer’s Disease Mice |
title_sort | stealth liposomes encapsulating a potent acat1/soat1 inhibitor f12511: pharmacokinetic, biodistribution, and toxicity studies in wild-type mice and efficacy studies in triple transgenic alzheimer’s disease mice |
topic | Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10341764/ https://www.ncbi.nlm.nih.gov/pubmed/37446191 http://dx.doi.org/10.3390/ijms241311013 |
work_keys_str_mv | AT delatorreadriannal stealthliposomesencapsulatingapotentacat1soat1inhibitorf12511pharmacokineticbiodistributionandtoxicitystudiesinwildtypemiceandefficacystudiesintripletransgenicalzheimersdiseasemice AT huynhthaon stealthliposomesencapsulatingapotentacat1soat1inhibitorf12511pharmacokineticbiodistributionandtoxicitystudiesinwildtypemiceandefficacystudiesintripletransgenicalzheimersdiseasemice AT changcatherinecy stealthliposomesencapsulatingapotentacat1soat1inhibitorf12511pharmacokineticbiodistributionandtoxicitystudiesinwildtypemiceandefficacystudiesintripletransgenicalzheimersdiseasemice AT poolerdarcyb stealthliposomesencapsulatingapotentacat1soat1inhibitorf12511pharmacokineticbiodistributionandtoxicitystudiesinwildtypemiceandefficacystudiesintripletransgenicalzheimersdiseasemice AT nessdylanb stealthliposomesencapsulatingapotentacat1soat1inhibitorf12511pharmacokineticbiodistributionandtoxicitystudiesinwildtypemiceandefficacystudiesintripletransgenicalzheimersdiseasemice AT lewislioneld stealthliposomesencapsulatingapotentacat1soat1inhibitorf12511pharmacokineticbiodistributionandtoxicitystudiesinwildtypemiceandefficacystudiesintripletransgenicalzheimersdiseasemice AT pannemsanjana stealthliposomesencapsulatingapotentacat1soat1inhibitorf12511pharmacokineticbiodistributionandtoxicitystudiesinwildtypemiceandefficacystudiesintripletransgenicalzheimersdiseasemice AT fengyichen stealthliposomesencapsulatingapotentacat1soat1inhibitorf12511pharmacokineticbiodistributionandtoxicitystudiesinwildtypemiceandefficacystudiesintripletransgenicalzheimersdiseasemice AT samkoekimberleys stealthliposomesencapsulatingapotentacat1soat1inhibitorf12511pharmacokineticbiodistributionandtoxicitystudiesinwildtypemiceandefficacystudiesintripletransgenicalzheimersdiseasemice AT hickeywilliamf stealthliposomesencapsulatingapotentacat1soat1inhibitorf12511pharmacokineticbiodistributionandtoxicitystudiesinwildtypemiceandefficacystudiesintripletransgenicalzheimersdiseasemice AT changtayuan stealthliposomesencapsulatingapotentacat1soat1inhibitorf12511pharmacokineticbiodistributionandtoxicitystudiesinwildtypemiceandefficacystudiesintripletransgenicalzheimersdiseasemice |