Cargando…

A Novel Germline Pathogenic Variant of RECQL4 Gene in an Iranian Pedigree with Familial Squamous Cell Carcinoma: A Brief Report

Squamous cell carcinoma (SCC) is the most common human solid tumor and the leading cause of cancer death. SCC of the breast is a very rare type of cancer that has not been well researched. Early identification of the genetic factors involved can lead to early diagnosis and targeted treatment. The pr...

Descripción completa

Detalles Bibliográficos
Autores principales: Amin, Mina, Mahmoodi-Khaledi, Elaheh, Narrei, Sina, Zeinalian, Mehrdad
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Shiraz University of Medical Sciences 2023
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10349162/
https://www.ncbi.nlm.nih.gov/pubmed/37456212
http://dx.doi.org/10.30476/IJMS.2022.94539.2587
_version_ 1785073841378164736
author Amin, Mina
Mahmoodi-Khaledi, Elaheh
Narrei, Sina
Zeinalian, Mehrdad
author_facet Amin, Mina
Mahmoodi-Khaledi, Elaheh
Narrei, Sina
Zeinalian, Mehrdad
author_sort Amin, Mina
collection PubMed
description Squamous cell carcinoma (SCC) is the most common human solid tumor and the leading cause of cancer death. SCC of the breast is a very rare type of cancer that has not been well researched. Early identification of the genetic factors involved can lead to early diagnosis and targeted treatment. The present study was conducted in 2018 at Isfahan University of Medical Sciences (Isfahan, Iran). The proband was a 66-year-old woman with SCC of the breast and a positive family history of cancer. Blood DNA samples were used for whole-exome sequencing to identify germline pathogenic variants. Variant annotation and prioritization were done on variant call format files using bioinformatics software tools. The screened variants were confirmed using the Sanger sequencing method. Co-segregation analysis was performed on the blood DNA samples of the first- and second-degree relatives of the proband to assess the presence of the mutation. A novel germline pathogenic variant was identified in the RECQL4 gene of the family. RECQL4 is a known protein in DNA repair and replication. Considering its effect on other types of SCC, it may play an important role in SCC initiation and progression in the breast.
format Online
Article
Text
id pubmed-10349162
institution National Center for Biotechnology Information
language English
publishDate 2023
publisher Shiraz University of Medical Sciences
record_format MEDLINE/PubMed
spelling pubmed-103491622023-07-16 A Novel Germline Pathogenic Variant of RECQL4 Gene in an Iranian Pedigree with Familial Squamous Cell Carcinoma: A Brief Report Amin, Mina Mahmoodi-Khaledi, Elaheh Narrei, Sina Zeinalian, Mehrdad Iran J Med Sci Brief Report Squamous cell carcinoma (SCC) is the most common human solid tumor and the leading cause of cancer death. SCC of the breast is a very rare type of cancer that has not been well researched. Early identification of the genetic factors involved can lead to early diagnosis and targeted treatment. The present study was conducted in 2018 at Isfahan University of Medical Sciences (Isfahan, Iran). The proband was a 66-year-old woman with SCC of the breast and a positive family history of cancer. Blood DNA samples were used for whole-exome sequencing to identify germline pathogenic variants. Variant annotation and prioritization were done on variant call format files using bioinformatics software tools. The screened variants were confirmed using the Sanger sequencing method. Co-segregation analysis was performed on the blood DNA samples of the first- and second-degree relatives of the proband to assess the presence of the mutation. A novel germline pathogenic variant was identified in the RECQL4 gene of the family. RECQL4 is a known protein in DNA repair and replication. Considering its effect on other types of SCC, it may play an important role in SCC initiation and progression in the breast. Shiraz University of Medical Sciences 2023-07 /pmc/articles/PMC10349162/ /pubmed/37456212 http://dx.doi.org/10.30476/IJMS.2022.94539.2587 Text en Copyright: © Iranian Journal of Medical Sciences https://creativecommons.org/licenses/by-nd/4.0/This is an open-access article distributed under the terms of the Creative Commons Attribution-NoDerivatives 4.0 International License. This license allows reusers to copy and distribute the material in any medium or format in unadapted form only, and only so long as attribution is given to the creator. The license allows for commercial use.
spellingShingle Brief Report
Amin, Mina
Mahmoodi-Khaledi, Elaheh
Narrei, Sina
Zeinalian, Mehrdad
A Novel Germline Pathogenic Variant of RECQL4 Gene in an Iranian Pedigree with Familial Squamous Cell Carcinoma: A Brief Report
title A Novel Germline Pathogenic Variant of RECQL4 Gene in an Iranian Pedigree with Familial Squamous Cell Carcinoma: A Brief Report
title_full A Novel Germline Pathogenic Variant of RECQL4 Gene in an Iranian Pedigree with Familial Squamous Cell Carcinoma: A Brief Report
title_fullStr A Novel Germline Pathogenic Variant of RECQL4 Gene in an Iranian Pedigree with Familial Squamous Cell Carcinoma: A Brief Report
title_full_unstemmed A Novel Germline Pathogenic Variant of RECQL4 Gene in an Iranian Pedigree with Familial Squamous Cell Carcinoma: A Brief Report
title_short A Novel Germline Pathogenic Variant of RECQL4 Gene in an Iranian Pedigree with Familial Squamous Cell Carcinoma: A Brief Report
title_sort novel germline pathogenic variant of recql4 gene in an iranian pedigree with familial squamous cell carcinoma: a brief report
topic Brief Report
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10349162/
https://www.ncbi.nlm.nih.gov/pubmed/37456212
http://dx.doi.org/10.30476/IJMS.2022.94539.2587
work_keys_str_mv AT aminmina anovelgermlinepathogenicvariantofrecql4geneinaniranianpedigreewithfamilialsquamouscellcarcinomaabriefreport
AT mahmoodikhaledielaheh anovelgermlinepathogenicvariantofrecql4geneinaniranianpedigreewithfamilialsquamouscellcarcinomaabriefreport
AT narreisina anovelgermlinepathogenicvariantofrecql4geneinaniranianpedigreewithfamilialsquamouscellcarcinomaabriefreport
AT zeinalianmehrdad anovelgermlinepathogenicvariantofrecql4geneinaniranianpedigreewithfamilialsquamouscellcarcinomaabriefreport
AT aminmina novelgermlinepathogenicvariantofrecql4geneinaniranianpedigreewithfamilialsquamouscellcarcinomaabriefreport
AT mahmoodikhaledielaheh novelgermlinepathogenicvariantofrecql4geneinaniranianpedigreewithfamilialsquamouscellcarcinomaabriefreport
AT narreisina novelgermlinepathogenicvariantofrecql4geneinaniranianpedigreewithfamilialsquamouscellcarcinomaabriefreport
AT zeinalianmehrdad novelgermlinepathogenicvariantofrecql4geneinaniranianpedigreewithfamilialsquamouscellcarcinomaabriefreport