Cargando…

Use of artificial intelligence in discerning the need for prostate biopsy and readiness for clinical practice: a systematic review protocol

BACKGROUND: Variability and inaccuracies in the diagnosis of prostate cancer, and the risk of complications from invasive tests, have been extensively reported in the research literature. To address this, the use of artificial intelligence (AI) has been attracting increased interest in recent years...

Descripción completa

Detalles Bibliográficos
Autores principales: Martinez-Marroquin, Elisa, Chau, Minh, Turner, Murray, Haxhimolla, Hodo, Paterson, Catherine
Formato: Online Artículo Texto
Lenguaje:English
Publicado: BioMed Central 2023
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10353135/
https://www.ncbi.nlm.nih.gov/pubmed/37461083
http://dx.doi.org/10.1186/s13643-023-02282-6
_version_ 1785074657612791808
author Martinez-Marroquin, Elisa
Chau, Minh
Turner, Murray
Haxhimolla, Hodo
Paterson, Catherine
author_facet Martinez-Marroquin, Elisa
Chau, Minh
Turner, Murray
Haxhimolla, Hodo
Paterson, Catherine
author_sort Martinez-Marroquin, Elisa
collection PubMed
description BACKGROUND: Variability and inaccuracies in the diagnosis of prostate cancer, and the risk of complications from invasive tests, have been extensively reported in the research literature. To address this, the use of artificial intelligence (AI) has been attracting increased interest in recent years to improve the diagnostic accuracy and objectivity. Although AI literature has reported promising results, further research is needed on the identification of evidence gaps that limit the potential adoption in prostate cancer screening practice. METHODS: A systematic electronic search strategy will be used to identify peer-reviewed articles published from inception to the date of searches and indexed in CINAHL, IEEE Xplore, MEDLINE, Scopus, and Web of Science Core Collection databases. Registries including Cochrane Central Register of Controlled Trials, ClinicalTrials.gov and International Clinical Trials Registry Platform (ICTRP) will be searched for unpublished studies, and experts were invited to provide suitable references. The research and reporting will be based on Cochrane recommendations and PRISMA guidelines, respectively. The screening and quality assessment of the articles will be conducted by two of the authors independently, and conflicts will be resolved by a third author. DISCUSSION: This systematic review will summarise the use of AI techniques to predict the need for prostate biopsy based on clinical and demographic indicators, including its diagnostic accuracy and readiness for adoption in clinical practice. SYSTEMATIC REVIEW REGISTRATION: PROSPERO CRD42022336540
format Online
Article
Text
id pubmed-10353135
institution National Center for Biotechnology Information
language English
publishDate 2023
publisher BioMed Central
record_format MEDLINE/PubMed
spelling pubmed-103531352023-07-19 Use of artificial intelligence in discerning the need for prostate biopsy and readiness for clinical practice: a systematic review protocol Martinez-Marroquin, Elisa Chau, Minh Turner, Murray Haxhimolla, Hodo Paterson, Catherine Syst Rev Protocol BACKGROUND: Variability and inaccuracies in the diagnosis of prostate cancer, and the risk of complications from invasive tests, have been extensively reported in the research literature. To address this, the use of artificial intelligence (AI) has been attracting increased interest in recent years to improve the diagnostic accuracy and objectivity. Although AI literature has reported promising results, further research is needed on the identification of evidence gaps that limit the potential adoption in prostate cancer screening practice. METHODS: A systematic electronic search strategy will be used to identify peer-reviewed articles published from inception to the date of searches and indexed in CINAHL, IEEE Xplore, MEDLINE, Scopus, and Web of Science Core Collection databases. Registries including Cochrane Central Register of Controlled Trials, ClinicalTrials.gov and International Clinical Trials Registry Platform (ICTRP) will be searched for unpublished studies, and experts were invited to provide suitable references. The research and reporting will be based on Cochrane recommendations and PRISMA guidelines, respectively. The screening and quality assessment of the articles will be conducted by two of the authors independently, and conflicts will be resolved by a third author. DISCUSSION: This systematic review will summarise the use of AI techniques to predict the need for prostate biopsy based on clinical and demographic indicators, including its diagnostic accuracy and readiness for adoption in clinical practice. SYSTEMATIC REVIEW REGISTRATION: PROSPERO CRD42022336540 BioMed Central 2023-07-17 /pmc/articles/PMC10353135/ /pubmed/37461083 http://dx.doi.org/10.1186/s13643-023-02282-6 Text en © The Author(s) 2023 https://creativecommons.org/licenses/by/4.0/Open Access This article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons licence, and indicate if changes were made. The images or other third party material in this article are included in the article's Creative Commons licence, unless indicated otherwise in a credit line to the material. If material is not included in the article's Creative Commons licence and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this licence, visit http://creativecommons.org/licenses/by/4.0/ (https://creativecommons.org/licenses/by/4.0/) . The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/ (https://creativecommons.org/publicdomain/zero/1.0/) ) applies to the data made available in this article, unless otherwise stated in a credit line to the data.
spellingShingle Protocol
Martinez-Marroquin, Elisa
Chau, Minh
Turner, Murray
Haxhimolla, Hodo
Paterson, Catherine
Use of artificial intelligence in discerning the need for prostate biopsy and readiness for clinical practice: a systematic review protocol
title Use of artificial intelligence in discerning the need for prostate biopsy and readiness for clinical practice: a systematic review protocol
title_full Use of artificial intelligence in discerning the need for prostate biopsy and readiness for clinical practice: a systematic review protocol
title_fullStr Use of artificial intelligence in discerning the need for prostate biopsy and readiness for clinical practice: a systematic review protocol
title_full_unstemmed Use of artificial intelligence in discerning the need for prostate biopsy and readiness for clinical practice: a systematic review protocol
title_short Use of artificial intelligence in discerning the need for prostate biopsy and readiness for clinical practice: a systematic review protocol
title_sort use of artificial intelligence in discerning the need for prostate biopsy and readiness for clinical practice: a systematic review protocol
topic Protocol
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10353135/
https://www.ncbi.nlm.nih.gov/pubmed/37461083
http://dx.doi.org/10.1186/s13643-023-02282-6
work_keys_str_mv AT martinezmarroquinelisa useofartificialintelligenceindiscerningtheneedforprostatebiopsyandreadinessforclinicalpracticeasystematicreviewprotocol
AT chauminh useofartificialintelligenceindiscerningtheneedforprostatebiopsyandreadinessforclinicalpracticeasystematicreviewprotocol
AT turnermurray useofartificialintelligenceindiscerningtheneedforprostatebiopsyandreadinessforclinicalpracticeasystematicreviewprotocol
AT haxhimollahodo useofartificialintelligenceindiscerningtheneedforprostatebiopsyandreadinessforclinicalpracticeasystematicreviewprotocol
AT patersoncatherine useofartificialintelligenceindiscerningtheneedforprostatebiopsyandreadinessforclinicalpracticeasystematicreviewprotocol