Cargando…

Concentration of mineral and heavy metals in raw mare (horse) milk consumed in Yazd, Iran: A risk assessment study

BACKGROUND: In recent years, the mare's milk has been introduced as a rich source of nutrients with hypoallergic characteristics which is widely used for Iranian infants. OBJECTIVES: The present study aimed to investigate the heavy metal concentration of mare's milk and its consumption ris...

Descripción completa

Detalles Bibliográficos
Autores principales: Alipour, Azar, Akrami Mohajeri, Fateme, Javdan, Gholamali, Pourramezani, Fatemeh, Fallahzadeh, Hossein, Khalili Sadrabad, Elham
Formato: Online Artículo Texto
Lenguaje:English
Publicado: John Wiley and Sons Inc. 2023
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10357269/
https://www.ncbi.nlm.nih.gov/pubmed/37067509
http://dx.doi.org/10.1002/vms3.1138
_version_ 1785075460736024576
author Alipour, Azar
Akrami Mohajeri, Fateme
Javdan, Gholamali
Pourramezani, Fatemeh
Fallahzadeh, Hossein
Khalili Sadrabad, Elham
author_facet Alipour, Azar
Akrami Mohajeri, Fateme
Javdan, Gholamali
Pourramezani, Fatemeh
Fallahzadeh, Hossein
Khalili Sadrabad, Elham
author_sort Alipour, Azar
collection PubMed
description BACKGROUND: In recent years, the mare's milk has been introduced as a rich source of nutrients with hypoallergic characteristics which is widely used for Iranian infants. OBJECTIVES: The present study aimed to investigate the heavy metal concentration of mare's milk and its consumption risk assessment. METHODS: About 88 mare's milk was collected from Yazd, the centre of Iran, during the summer of 2020. The raw mare's milk was digested and analysed for mineral and heavy metal content (As, Ca, Cd, Co, Cu, Fe, Mg, Mn, Ni, P, Pb and Zn) by ICP‐OES. To estimate the health hazard for consumers the Estimated Daily Intake (EDI), Hazard Quotient (HQ) and Hazard Index (HI) of heavy metals were determined. RESULTS: The Ca ranged from 260.52 to 201.43 mg/L, which was the highest mineral in mare's milk followed by P and Mg. By increasing the age, P and Ca content was increased. The obtained ranges of Cu, Co, Fe, Mn and Zn were 72.12–75.11, 1.12–9.3, 180.69–230.21, 31.24–47.13 and 1060–1200 μg/L, respectively. The Cd and Arsenic content of mares' 8–11 years of age had higher concentrations. The highest Pb content was reported in mares 4–7 years old (10 μg/L). Although, Pb, Cd and As content of the mare's milk was evaluated lower than the permissible limit. Also, the HQ value was As > Cd > Pb > Zn > Ni > Cu for infants, toddlers and adults. The HI of mare's milk was 0.16, 0.15 and 0.022 for infants, toddlers and adults, respectively. CONCLUSIONS: Mare's milk could be an effective nutrition source for infants and children suffering from milk protein allergies.
format Online
Article
Text
id pubmed-10357269
institution National Center for Biotechnology Information
language English
publishDate 2023
publisher John Wiley and Sons Inc.
record_format MEDLINE/PubMed
spelling pubmed-103572692023-07-21 Concentration of mineral and heavy metals in raw mare (horse) milk consumed in Yazd, Iran: A risk assessment study Alipour, Azar Akrami Mohajeri, Fateme Javdan, Gholamali Pourramezani, Fatemeh Fallahzadeh, Hossein Khalili Sadrabad, Elham Vet Med Sci EQUINE BACKGROUND: In recent years, the mare's milk has been introduced as a rich source of nutrients with hypoallergic characteristics which is widely used for Iranian infants. OBJECTIVES: The present study aimed to investigate the heavy metal concentration of mare's milk and its consumption risk assessment. METHODS: About 88 mare's milk was collected from Yazd, the centre of Iran, during the summer of 2020. The raw mare's milk was digested and analysed for mineral and heavy metal content (As, Ca, Cd, Co, Cu, Fe, Mg, Mn, Ni, P, Pb and Zn) by ICP‐OES. To estimate the health hazard for consumers the Estimated Daily Intake (EDI), Hazard Quotient (HQ) and Hazard Index (HI) of heavy metals were determined. RESULTS: The Ca ranged from 260.52 to 201.43 mg/L, which was the highest mineral in mare's milk followed by P and Mg. By increasing the age, P and Ca content was increased. The obtained ranges of Cu, Co, Fe, Mn and Zn were 72.12–75.11, 1.12–9.3, 180.69–230.21, 31.24–47.13 and 1060–1200 μg/L, respectively. The Cd and Arsenic content of mares' 8–11 years of age had higher concentrations. The highest Pb content was reported in mares 4–7 years old (10 μg/L). Although, Pb, Cd and As content of the mare's milk was evaluated lower than the permissible limit. Also, the HQ value was As > Cd > Pb > Zn > Ni > Cu for infants, toddlers and adults. The HI of mare's milk was 0.16, 0.15 and 0.022 for infants, toddlers and adults, respectively. CONCLUSIONS: Mare's milk could be an effective nutrition source for infants and children suffering from milk protein allergies. John Wiley and Sons Inc. 2023-04-17 /pmc/articles/PMC10357269/ /pubmed/37067509 http://dx.doi.org/10.1002/vms3.1138 Text en © 2023 The Authors. Veterinary Medicine and Science published by John Wiley & Sons Ltd. https://creativecommons.org/licenses/by/4.0/This is an open access article under the terms of the http://creativecommons.org/licenses/by/4.0/ (https://creativecommons.org/licenses/by/4.0/) License, which permits use, distribution and reproduction in any medium, provided the original work is properly cited.
spellingShingle EQUINE
Alipour, Azar
Akrami Mohajeri, Fateme
Javdan, Gholamali
Pourramezani, Fatemeh
Fallahzadeh, Hossein
Khalili Sadrabad, Elham
Concentration of mineral and heavy metals in raw mare (horse) milk consumed in Yazd, Iran: A risk assessment study
title Concentration of mineral and heavy metals in raw mare (horse) milk consumed in Yazd, Iran: A risk assessment study
title_full Concentration of mineral and heavy metals in raw mare (horse) milk consumed in Yazd, Iran: A risk assessment study
title_fullStr Concentration of mineral and heavy metals in raw mare (horse) milk consumed in Yazd, Iran: A risk assessment study
title_full_unstemmed Concentration of mineral and heavy metals in raw mare (horse) milk consumed in Yazd, Iran: A risk assessment study
title_short Concentration of mineral and heavy metals in raw mare (horse) milk consumed in Yazd, Iran: A risk assessment study
title_sort concentration of mineral and heavy metals in raw mare (horse) milk consumed in yazd, iran: a risk assessment study
topic EQUINE
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10357269/
https://www.ncbi.nlm.nih.gov/pubmed/37067509
http://dx.doi.org/10.1002/vms3.1138
work_keys_str_mv AT alipourazar concentrationofmineralandheavymetalsinrawmarehorsemilkconsumedinyazdiranariskassessmentstudy
AT akramimohajerifateme concentrationofmineralandheavymetalsinrawmarehorsemilkconsumedinyazdiranariskassessmentstudy
AT javdangholamali concentrationofmineralandheavymetalsinrawmarehorsemilkconsumedinyazdiranariskassessmentstudy
AT pourramezanifatemeh concentrationofmineralandheavymetalsinrawmarehorsemilkconsumedinyazdiranariskassessmentstudy
AT fallahzadehhossein concentrationofmineralandheavymetalsinrawmarehorsemilkconsumedinyazdiranariskassessmentstudy
AT khalilisadrabadelham concentrationofmineralandheavymetalsinrawmarehorsemilkconsumedinyazdiranariskassessmentstudy