Cargando…
Concentration of mineral and heavy metals in raw mare (horse) milk consumed in Yazd, Iran: A risk assessment study
BACKGROUND: In recent years, the mare's milk has been introduced as a rich source of nutrients with hypoallergic characteristics which is widely used for Iranian infants. OBJECTIVES: The present study aimed to investigate the heavy metal concentration of mare's milk and its consumption ris...
Autores principales: | , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
John Wiley and Sons Inc.
2023
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10357269/ https://www.ncbi.nlm.nih.gov/pubmed/37067509 http://dx.doi.org/10.1002/vms3.1138 |
_version_ | 1785075460736024576 |
---|---|
author | Alipour, Azar Akrami Mohajeri, Fateme Javdan, Gholamali Pourramezani, Fatemeh Fallahzadeh, Hossein Khalili Sadrabad, Elham |
author_facet | Alipour, Azar Akrami Mohajeri, Fateme Javdan, Gholamali Pourramezani, Fatemeh Fallahzadeh, Hossein Khalili Sadrabad, Elham |
author_sort | Alipour, Azar |
collection | PubMed |
description | BACKGROUND: In recent years, the mare's milk has been introduced as a rich source of nutrients with hypoallergic characteristics which is widely used for Iranian infants. OBJECTIVES: The present study aimed to investigate the heavy metal concentration of mare's milk and its consumption risk assessment. METHODS: About 88 mare's milk was collected from Yazd, the centre of Iran, during the summer of 2020. The raw mare's milk was digested and analysed for mineral and heavy metal content (As, Ca, Cd, Co, Cu, Fe, Mg, Mn, Ni, P, Pb and Zn) by ICP‐OES. To estimate the health hazard for consumers the Estimated Daily Intake (EDI), Hazard Quotient (HQ) and Hazard Index (HI) of heavy metals were determined. RESULTS: The Ca ranged from 260.52 to 201.43 mg/L, which was the highest mineral in mare's milk followed by P and Mg. By increasing the age, P and Ca content was increased. The obtained ranges of Cu, Co, Fe, Mn and Zn were 72.12–75.11, 1.12–9.3, 180.69–230.21, 31.24–47.13 and 1060–1200 μg/L, respectively. The Cd and Arsenic content of mares' 8–11 years of age had higher concentrations. The highest Pb content was reported in mares 4–7 years old (10 μg/L). Although, Pb, Cd and As content of the mare's milk was evaluated lower than the permissible limit. Also, the HQ value was As > Cd > Pb > Zn > Ni > Cu for infants, toddlers and adults. The HI of mare's milk was 0.16, 0.15 and 0.022 for infants, toddlers and adults, respectively. CONCLUSIONS: Mare's milk could be an effective nutrition source for infants and children suffering from milk protein allergies. |
format | Online Article Text |
id | pubmed-10357269 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2023 |
publisher | John Wiley and Sons Inc. |
record_format | MEDLINE/PubMed |
spelling | pubmed-103572692023-07-21 Concentration of mineral and heavy metals in raw mare (horse) milk consumed in Yazd, Iran: A risk assessment study Alipour, Azar Akrami Mohajeri, Fateme Javdan, Gholamali Pourramezani, Fatemeh Fallahzadeh, Hossein Khalili Sadrabad, Elham Vet Med Sci EQUINE BACKGROUND: In recent years, the mare's milk has been introduced as a rich source of nutrients with hypoallergic characteristics which is widely used for Iranian infants. OBJECTIVES: The present study aimed to investigate the heavy metal concentration of mare's milk and its consumption risk assessment. METHODS: About 88 mare's milk was collected from Yazd, the centre of Iran, during the summer of 2020. The raw mare's milk was digested and analysed for mineral and heavy metal content (As, Ca, Cd, Co, Cu, Fe, Mg, Mn, Ni, P, Pb and Zn) by ICP‐OES. To estimate the health hazard for consumers the Estimated Daily Intake (EDI), Hazard Quotient (HQ) and Hazard Index (HI) of heavy metals were determined. RESULTS: The Ca ranged from 260.52 to 201.43 mg/L, which was the highest mineral in mare's milk followed by P and Mg. By increasing the age, P and Ca content was increased. The obtained ranges of Cu, Co, Fe, Mn and Zn were 72.12–75.11, 1.12–9.3, 180.69–230.21, 31.24–47.13 and 1060–1200 μg/L, respectively. The Cd and Arsenic content of mares' 8–11 years of age had higher concentrations. The highest Pb content was reported in mares 4–7 years old (10 μg/L). Although, Pb, Cd and As content of the mare's milk was evaluated lower than the permissible limit. Also, the HQ value was As > Cd > Pb > Zn > Ni > Cu for infants, toddlers and adults. The HI of mare's milk was 0.16, 0.15 and 0.022 for infants, toddlers and adults, respectively. CONCLUSIONS: Mare's milk could be an effective nutrition source for infants and children suffering from milk protein allergies. John Wiley and Sons Inc. 2023-04-17 /pmc/articles/PMC10357269/ /pubmed/37067509 http://dx.doi.org/10.1002/vms3.1138 Text en © 2023 The Authors. Veterinary Medicine and Science published by John Wiley & Sons Ltd. https://creativecommons.org/licenses/by/4.0/This is an open access article under the terms of the http://creativecommons.org/licenses/by/4.0/ (https://creativecommons.org/licenses/by/4.0/) License, which permits use, distribution and reproduction in any medium, provided the original work is properly cited. |
spellingShingle | EQUINE Alipour, Azar Akrami Mohajeri, Fateme Javdan, Gholamali Pourramezani, Fatemeh Fallahzadeh, Hossein Khalili Sadrabad, Elham Concentration of mineral and heavy metals in raw mare (horse) milk consumed in Yazd, Iran: A risk assessment study |
title | Concentration of mineral and heavy metals in raw mare (horse) milk consumed in Yazd, Iran: A risk assessment study |
title_full | Concentration of mineral and heavy metals in raw mare (horse) milk consumed in Yazd, Iran: A risk assessment study |
title_fullStr | Concentration of mineral and heavy metals in raw mare (horse) milk consumed in Yazd, Iran: A risk assessment study |
title_full_unstemmed | Concentration of mineral and heavy metals in raw mare (horse) milk consumed in Yazd, Iran: A risk assessment study |
title_short | Concentration of mineral and heavy metals in raw mare (horse) milk consumed in Yazd, Iran: A risk assessment study |
title_sort | concentration of mineral and heavy metals in raw mare (horse) milk consumed in yazd, iran: a risk assessment study |
topic | EQUINE |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10357269/ https://www.ncbi.nlm.nih.gov/pubmed/37067509 http://dx.doi.org/10.1002/vms3.1138 |
work_keys_str_mv | AT alipourazar concentrationofmineralandheavymetalsinrawmarehorsemilkconsumedinyazdiranariskassessmentstudy AT akramimohajerifateme concentrationofmineralandheavymetalsinrawmarehorsemilkconsumedinyazdiranariskassessmentstudy AT javdangholamali concentrationofmineralandheavymetalsinrawmarehorsemilkconsumedinyazdiranariskassessmentstudy AT pourramezanifatemeh concentrationofmineralandheavymetalsinrawmarehorsemilkconsumedinyazdiranariskassessmentstudy AT fallahzadehhossein concentrationofmineralandheavymetalsinrawmarehorsemilkconsumedinyazdiranariskassessmentstudy AT khalilisadrabadelham concentrationofmineralandheavymetalsinrawmarehorsemilkconsumedinyazdiranariskassessmentstudy |