Cargando…
Oestrogen ameliorates blood-brain barrier damage after experimental subarachnoid haemorrhage via the SHH pathway in male rats
BACKGROUND: Sex differences affect the occurrence, progression and regression of subarachnoid haemorrhage (SAH). Oestrogen plays a protective role in alleviating the vasospasm and neuronal apoptosis induced by SAH. However, whether oestrogen affects blood‒brain barrier (BBB) integrity has not been f...
Autores principales: | , , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
BMJ Publishing Group
2022
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10359806/ https://www.ncbi.nlm.nih.gov/pubmed/36526331 http://dx.doi.org/10.1136/svn-2022-001907 |
_version_ | 1785075964341911552 |
---|---|
author | Zhang, Jie Li, Haiying Xu, Zhongmou Lu, Jinxin Cao, Chang Shen, Haitao Li, Xiang You, Wanchun Chen, Gang |
author_facet | Zhang, Jie Li, Haiying Xu, Zhongmou Lu, Jinxin Cao, Chang Shen, Haitao Li, Xiang You, Wanchun Chen, Gang |
author_sort | Zhang, Jie |
collection | PubMed |
description | BACKGROUND: Sex differences affect the occurrence, progression and regression of subarachnoid haemorrhage (SAH). Oestrogen plays a protective role in alleviating the vasospasm and neuronal apoptosis induced by SAH. However, whether oestrogen affects blood‒brain barrier (BBB) integrity has not been fully studied. Oestrogen has been found to regulate the sonic hedgehog (SHH) signalling pathway through the oestrogen receptor in gastric cancer and adrenal glands, and the SHH signalling pathway has an important role in maintaining the BBB by upregulating the expression of tight junction proteins. In this study, we investigated the relationship between oestrogen and the SHH signalling pathway using clinical data and established an experimental SAH model to explore whether oestrogen could ameliorate BBB damage after SAH through the SHH pathway. METHODS: Correlations between oestrogen and the SHH pathway were analysed by patients’ cerebrospinal fluid (CSF) samples and the Genotype-Tissue Expression database (GTEx). Then, an experimental rat SAH model was established using the endovascular perforation method and treated with oestrogen, oestrogen inhibitors and SHH signalling pathway inhibitors. Then, the effects of oestrogen on BBB damage were analysed by western blot, immunofluorescence and neurobehavioural experiments. RESULTS: ESLIA detection and correlation analysis showed that oestrogen levels in patients’ CSF were positively correlated with the SHH pathway, which was further verified by GTEx gene-correlation analysis. SHH was found to be mainly expressed in neurons and astrocytes in rats under physiological conditions and was upregulated by oestrogen pretreatment. In the SAH model, oestrogen pretreatment was found to reverse SAH-induced decreases in the SHH pathway, which were counteracted by oestrogen receptor inhibitors. Furthermore, oestrogen pretreatment reduced SAH-induced BBB damage, brain oedema and neurological dysfunction, which were eliminated by SHH pathway inhibitors. CONCLUSION: In conclusion, we demonstrate here that oestrogen pretreatment ameliorates brain injury after SAH, at least in part through SHH pathway-mediated BBB protection. |
format | Online Article Text |
id | pubmed-10359806 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2022 |
publisher | BMJ Publishing Group |
record_format | MEDLINE/PubMed |
spelling | pubmed-103598062023-07-22 Oestrogen ameliorates blood-brain barrier damage after experimental subarachnoid haemorrhage via the SHH pathway in male rats Zhang, Jie Li, Haiying Xu, Zhongmou Lu, Jinxin Cao, Chang Shen, Haitao Li, Xiang You, Wanchun Chen, Gang Stroke Vasc Neurol Original Research BACKGROUND: Sex differences affect the occurrence, progression and regression of subarachnoid haemorrhage (SAH). Oestrogen plays a protective role in alleviating the vasospasm and neuronal apoptosis induced by SAH. However, whether oestrogen affects blood‒brain barrier (BBB) integrity has not been fully studied. Oestrogen has been found to regulate the sonic hedgehog (SHH) signalling pathway through the oestrogen receptor in gastric cancer and adrenal glands, and the SHH signalling pathway has an important role in maintaining the BBB by upregulating the expression of tight junction proteins. In this study, we investigated the relationship between oestrogen and the SHH signalling pathway using clinical data and established an experimental SAH model to explore whether oestrogen could ameliorate BBB damage after SAH through the SHH pathway. METHODS: Correlations between oestrogen and the SHH pathway were analysed by patients’ cerebrospinal fluid (CSF) samples and the Genotype-Tissue Expression database (GTEx). Then, an experimental rat SAH model was established using the endovascular perforation method and treated with oestrogen, oestrogen inhibitors and SHH signalling pathway inhibitors. Then, the effects of oestrogen on BBB damage were analysed by western blot, immunofluorescence and neurobehavioural experiments. RESULTS: ESLIA detection and correlation analysis showed that oestrogen levels in patients’ CSF were positively correlated with the SHH pathway, which was further verified by GTEx gene-correlation analysis. SHH was found to be mainly expressed in neurons and astrocytes in rats under physiological conditions and was upregulated by oestrogen pretreatment. In the SAH model, oestrogen pretreatment was found to reverse SAH-induced decreases in the SHH pathway, which were counteracted by oestrogen receptor inhibitors. Furthermore, oestrogen pretreatment reduced SAH-induced BBB damage, brain oedema and neurological dysfunction, which were eliminated by SHH pathway inhibitors. CONCLUSION: In conclusion, we demonstrate here that oestrogen pretreatment ameliorates brain injury after SAH, at least in part through SHH pathway-mediated BBB protection. BMJ Publishing Group 2022-12-16 /pmc/articles/PMC10359806/ /pubmed/36526331 http://dx.doi.org/10.1136/svn-2022-001907 Text en © Author(s) (or their employer(s)) 2023. Re-use permitted under CC BY-NC. No commercial re-use. See rights and permissions. Published by BMJ. https://creativecommons.org/licenses/by-nc/4.0/This is an open access article distributed in accordance with the Creative Commons Attribution Non Commercial (CC BY-NC 4.0) license, which permits others to distribute, remix, adapt, build upon this work non-commercially, and license their derivative works on different terms, provided the original work is properly cited, appropriate credit is given, any changes made indicated, and the use is non-commercial. See: http://creativecommons.org/licenses/by-nc/4.0/ (https://creativecommons.org/licenses/by-nc/4.0/) . |
spellingShingle | Original Research Zhang, Jie Li, Haiying Xu, Zhongmou Lu, Jinxin Cao, Chang Shen, Haitao Li, Xiang You, Wanchun Chen, Gang Oestrogen ameliorates blood-brain barrier damage after experimental subarachnoid haemorrhage via the SHH pathway in male rats |
title | Oestrogen ameliorates blood-brain barrier damage after experimental subarachnoid haemorrhage via the SHH pathway in male rats |
title_full | Oestrogen ameliorates blood-brain barrier damage after experimental subarachnoid haemorrhage via the SHH pathway in male rats |
title_fullStr | Oestrogen ameliorates blood-brain barrier damage after experimental subarachnoid haemorrhage via the SHH pathway in male rats |
title_full_unstemmed | Oestrogen ameliorates blood-brain barrier damage after experimental subarachnoid haemorrhage via the SHH pathway in male rats |
title_short | Oestrogen ameliorates blood-brain barrier damage after experimental subarachnoid haemorrhage via the SHH pathway in male rats |
title_sort | oestrogen ameliorates blood-brain barrier damage after experimental subarachnoid haemorrhage via the shh pathway in male rats |
topic | Original Research |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10359806/ https://www.ncbi.nlm.nih.gov/pubmed/36526331 http://dx.doi.org/10.1136/svn-2022-001907 |
work_keys_str_mv | AT zhangjie oestrogenamelioratesbloodbrainbarrierdamageafterexperimentalsubarachnoidhaemorrhageviatheshhpathwayinmalerats AT lihaiying oestrogenamelioratesbloodbrainbarrierdamageafterexperimentalsubarachnoidhaemorrhageviatheshhpathwayinmalerats AT xuzhongmou oestrogenamelioratesbloodbrainbarrierdamageafterexperimentalsubarachnoidhaemorrhageviatheshhpathwayinmalerats AT lujinxin oestrogenamelioratesbloodbrainbarrierdamageafterexperimentalsubarachnoidhaemorrhageviatheshhpathwayinmalerats AT caochang oestrogenamelioratesbloodbrainbarrierdamageafterexperimentalsubarachnoidhaemorrhageviatheshhpathwayinmalerats AT shenhaitao oestrogenamelioratesbloodbrainbarrierdamageafterexperimentalsubarachnoidhaemorrhageviatheshhpathwayinmalerats AT lixiang oestrogenamelioratesbloodbrainbarrierdamageafterexperimentalsubarachnoidhaemorrhageviatheshhpathwayinmalerats AT youwanchun oestrogenamelioratesbloodbrainbarrierdamageafterexperimentalsubarachnoidhaemorrhageviatheshhpathwayinmalerats AT chengang oestrogenamelioratesbloodbrainbarrierdamageafterexperimentalsubarachnoidhaemorrhageviatheshhpathwayinmalerats |