Cargando…
Mini review: Current status and perspective of S100B protein as a biomarker in daily clinical practice for diagnosis and prognosticating of clinical outcome in patients with neurological diseases with focus on acute brain injury
Prognosticating the clinical outcome of neurological diseases is essential to guide treatment and facilitate decision-making. It usually depends on clinical and radiological findings. Biomarkers have been suggested to support this process, as they are deemed objective measures and can express the ex...
Autores principales: | , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
BioMed Central
2023
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10360330/ https://www.ncbi.nlm.nih.gov/pubmed/37474905 http://dx.doi.org/10.1186/s12868-023-00807-2 |
_version_ | 1785076081459462144 |
---|---|
author | Abboud, Tammam Rohde, Veit Mielke, Dorothee |
author_facet | Abboud, Tammam Rohde, Veit Mielke, Dorothee |
author_sort | Abboud, Tammam |
collection | PubMed |
description | Prognosticating the clinical outcome of neurological diseases is essential to guide treatment and facilitate decision-making. It usually depends on clinical and radiological findings. Biomarkers have been suggested to support this process, as they are deemed objective measures and can express the extent of tissue damage or reflect the degree of inflammation. Some of them are specific, and some are not. Few of them, however, reached the stage of daily application in clinical practice. This mini review covers available applications of the S100B protein in prognosticating clinical outcome in patients with various neurological disorders, particularly in those with traumatic brain injury, spontaneous subarachnoid hemorrhage and ischemic stroke. The aim is to provide an understandable picture of the clinical use of the S100B protein and give a brief overview of the current limitations that require future solutions. |
format | Online Article Text |
id | pubmed-10360330 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2023 |
publisher | BioMed Central |
record_format | MEDLINE/PubMed |
spelling | pubmed-103603302023-07-22 Mini review: Current status and perspective of S100B protein as a biomarker in daily clinical practice for diagnosis and prognosticating of clinical outcome in patients with neurological diseases with focus on acute brain injury Abboud, Tammam Rohde, Veit Mielke, Dorothee BMC Neurosci Review Prognosticating the clinical outcome of neurological diseases is essential to guide treatment and facilitate decision-making. It usually depends on clinical and radiological findings. Biomarkers have been suggested to support this process, as they are deemed objective measures and can express the extent of tissue damage or reflect the degree of inflammation. Some of them are specific, and some are not. Few of them, however, reached the stage of daily application in clinical practice. This mini review covers available applications of the S100B protein in prognosticating clinical outcome in patients with various neurological disorders, particularly in those with traumatic brain injury, spontaneous subarachnoid hemorrhage and ischemic stroke. The aim is to provide an understandable picture of the clinical use of the S100B protein and give a brief overview of the current limitations that require future solutions. BioMed Central 2023-07-20 /pmc/articles/PMC10360330/ /pubmed/37474905 http://dx.doi.org/10.1186/s12868-023-00807-2 Text en © The Author(s) 2023 https://creativecommons.org/licenses/by/4.0/Open Access This article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons licence, and indicate if changes were made. The images or other third party material in this article are included in the article’s Creative Commons licence, unless indicated otherwise in a credit line to the material. If material is not included in the article’s Creative Commons licence and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this licence, visit http://creativecommons.org/licenses/by/4.0/ (https://creativecommons.org/licenses/by/4.0/) . The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/ (https://creativecommons.org/publicdomain/zero/1.0/) ) applies to the data made available in this article, unless otherwise stated in a credit line to the data. |
spellingShingle | Review Abboud, Tammam Rohde, Veit Mielke, Dorothee Mini review: Current status and perspective of S100B protein as a biomarker in daily clinical practice for diagnosis and prognosticating of clinical outcome in patients with neurological diseases with focus on acute brain injury |
title | Mini review: Current status and perspective of S100B protein as a biomarker in daily clinical practice for diagnosis and prognosticating of clinical outcome in patients with neurological diseases with focus on acute brain injury |
title_full | Mini review: Current status and perspective of S100B protein as a biomarker in daily clinical practice for diagnosis and prognosticating of clinical outcome in patients with neurological diseases with focus on acute brain injury |
title_fullStr | Mini review: Current status and perspective of S100B protein as a biomarker in daily clinical practice for diagnosis and prognosticating of clinical outcome in patients with neurological diseases with focus on acute brain injury |
title_full_unstemmed | Mini review: Current status and perspective of S100B protein as a biomarker in daily clinical practice for diagnosis and prognosticating of clinical outcome in patients with neurological diseases with focus on acute brain injury |
title_short | Mini review: Current status and perspective of S100B protein as a biomarker in daily clinical practice for diagnosis and prognosticating of clinical outcome in patients with neurological diseases with focus on acute brain injury |
title_sort | mini review: current status and perspective of s100b protein as a biomarker in daily clinical practice for diagnosis and prognosticating of clinical outcome in patients with neurological diseases with focus on acute brain injury |
topic | Review |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10360330/ https://www.ncbi.nlm.nih.gov/pubmed/37474905 http://dx.doi.org/10.1186/s12868-023-00807-2 |
work_keys_str_mv | AT abboudtammam minireviewcurrentstatusandperspectiveofs100bproteinasabiomarkerindailyclinicalpracticefordiagnosisandprognosticatingofclinicaloutcomeinpatientswithneurologicaldiseaseswithfocusonacutebraininjury AT rohdeveit minireviewcurrentstatusandperspectiveofs100bproteinasabiomarkerindailyclinicalpracticefordiagnosisandprognosticatingofclinicaloutcomeinpatientswithneurologicaldiseaseswithfocusonacutebraininjury AT mielkedorothee minireviewcurrentstatusandperspectiveofs100bproteinasabiomarkerindailyclinicalpracticefordiagnosisandprognosticatingofclinicaloutcomeinpatientswithneurologicaldiseaseswithfocusonacutebraininjury |