Cargando…

Mini review: Current status and perspective of S100B protein as a biomarker in daily clinical practice for diagnosis and prognosticating of clinical outcome in patients with neurological diseases with focus on acute brain injury

Prognosticating the clinical outcome of neurological diseases is essential to guide treatment and facilitate decision-making. It usually depends on clinical and radiological findings. Biomarkers have been suggested to support this process, as they are deemed objective measures and can express the ex...

Descripción completa

Detalles Bibliográficos
Autores principales: Abboud, Tammam, Rohde, Veit, Mielke, Dorothee
Formato: Online Artículo Texto
Lenguaje:English
Publicado: BioMed Central 2023
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10360330/
https://www.ncbi.nlm.nih.gov/pubmed/37474905
http://dx.doi.org/10.1186/s12868-023-00807-2
_version_ 1785076081459462144
author Abboud, Tammam
Rohde, Veit
Mielke, Dorothee
author_facet Abboud, Tammam
Rohde, Veit
Mielke, Dorothee
author_sort Abboud, Tammam
collection PubMed
description Prognosticating the clinical outcome of neurological diseases is essential to guide treatment and facilitate decision-making. It usually depends on clinical and radiological findings. Biomarkers have been suggested to support this process, as they are deemed objective measures and can express the extent of tissue damage or reflect the degree of inflammation. Some of them are specific, and some are not. Few of them, however, reached the stage of daily application in clinical practice. This mini review covers available applications of the S100B protein in prognosticating clinical outcome in patients with various neurological disorders, particularly in those with traumatic brain injury, spontaneous subarachnoid hemorrhage and ischemic stroke. The aim is to provide an understandable picture of the clinical use of the S100B protein and give a brief overview of the current limitations that require future solutions.
format Online
Article
Text
id pubmed-10360330
institution National Center for Biotechnology Information
language English
publishDate 2023
publisher BioMed Central
record_format MEDLINE/PubMed
spelling pubmed-103603302023-07-22 Mini review: Current status and perspective of S100B protein as a biomarker in daily clinical practice for diagnosis and prognosticating of clinical outcome in patients with neurological diseases with focus on acute brain injury Abboud, Tammam Rohde, Veit Mielke, Dorothee BMC Neurosci Review Prognosticating the clinical outcome of neurological diseases is essential to guide treatment and facilitate decision-making. It usually depends on clinical and radiological findings. Biomarkers have been suggested to support this process, as they are deemed objective measures and can express the extent of tissue damage or reflect the degree of inflammation. Some of them are specific, and some are not. Few of them, however, reached the stage of daily application in clinical practice. This mini review covers available applications of the S100B protein in prognosticating clinical outcome in patients with various neurological disorders, particularly in those with traumatic brain injury, spontaneous subarachnoid hemorrhage and ischemic stroke. The aim is to provide an understandable picture of the clinical use of the S100B protein and give a brief overview of the current limitations that require future solutions. BioMed Central 2023-07-20 /pmc/articles/PMC10360330/ /pubmed/37474905 http://dx.doi.org/10.1186/s12868-023-00807-2 Text en © The Author(s) 2023 https://creativecommons.org/licenses/by/4.0/Open Access This article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons licence, and indicate if changes were made. The images or other third party material in this article are included in the article’s Creative Commons licence, unless indicated otherwise in a credit line to the material. If material is not included in the article’s Creative Commons licence and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this licence, visit http://creativecommons.org/licenses/by/4.0/ (https://creativecommons.org/licenses/by/4.0/) . The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/ (https://creativecommons.org/publicdomain/zero/1.0/) ) applies to the data made available in this article, unless otherwise stated in a credit line to the data.
spellingShingle Review
Abboud, Tammam
Rohde, Veit
Mielke, Dorothee
Mini review: Current status and perspective of S100B protein as a biomarker in daily clinical practice for diagnosis and prognosticating of clinical outcome in patients with neurological diseases with focus on acute brain injury
title Mini review: Current status and perspective of S100B protein as a biomarker in daily clinical practice for diagnosis and prognosticating of clinical outcome in patients with neurological diseases with focus on acute brain injury
title_full Mini review: Current status and perspective of S100B protein as a biomarker in daily clinical practice for diagnosis and prognosticating of clinical outcome in patients with neurological diseases with focus on acute brain injury
title_fullStr Mini review: Current status and perspective of S100B protein as a biomarker in daily clinical practice for diagnosis and prognosticating of clinical outcome in patients with neurological diseases with focus on acute brain injury
title_full_unstemmed Mini review: Current status and perspective of S100B protein as a biomarker in daily clinical practice for diagnosis and prognosticating of clinical outcome in patients with neurological diseases with focus on acute brain injury
title_short Mini review: Current status and perspective of S100B protein as a biomarker in daily clinical practice for diagnosis and prognosticating of clinical outcome in patients with neurological diseases with focus on acute brain injury
title_sort mini review: current status and perspective of s100b protein as a biomarker in daily clinical practice for diagnosis and prognosticating of clinical outcome in patients with neurological diseases with focus on acute brain injury
topic Review
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10360330/
https://www.ncbi.nlm.nih.gov/pubmed/37474905
http://dx.doi.org/10.1186/s12868-023-00807-2
work_keys_str_mv AT abboudtammam minireviewcurrentstatusandperspectiveofs100bproteinasabiomarkerindailyclinicalpracticefordiagnosisandprognosticatingofclinicaloutcomeinpatientswithneurologicaldiseaseswithfocusonacutebraininjury
AT rohdeveit minireviewcurrentstatusandperspectiveofs100bproteinasabiomarkerindailyclinicalpracticefordiagnosisandprognosticatingofclinicaloutcomeinpatientswithneurologicaldiseaseswithfocusonacutebraininjury
AT mielkedorothee minireviewcurrentstatusandperspectiveofs100bproteinasabiomarkerindailyclinicalpracticefordiagnosisandprognosticatingofclinicaloutcomeinpatientswithneurologicaldiseaseswithfocusonacutebraininjury