Cargando…
Sericin coated thin polymeric films reduce keratinocyte proliferation via the mTOR pathway and epidermal inflammation through IL17 signaling in psoriasis rat model
Therapeutic treatment forms can play significant roles in resolving psoriatic plaques or promoting wound repair in psoriatic skin. Considering the biocompatibility, mechanical strength, flexibility, and adhesive properties of silk fibroin sheets/films, it is useful to combine them with anti-psoriati...
Autores principales: | , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Nature Publishing Group UK
2023
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10372088/ https://www.ncbi.nlm.nih.gov/pubmed/37495626 http://dx.doi.org/10.1038/s41598-023-39218-y |
_version_ | 1785078293550071808 |
---|---|
author | Aramwit, Pornanong Fongsodsri, Kamonpan Tuentam, Khwanchanok Reamtong, Onrapak Thiangtrongjit, Tipparat Kanjanapruthipong, Tapanee Yadavalli, Vamsi K. Ampawong, Sumate |
author_facet | Aramwit, Pornanong Fongsodsri, Kamonpan Tuentam, Khwanchanok Reamtong, Onrapak Thiangtrongjit, Tipparat Kanjanapruthipong, Tapanee Yadavalli, Vamsi K. Ampawong, Sumate |
author_sort | Aramwit, Pornanong |
collection | PubMed |
description | Therapeutic treatment forms can play significant roles in resolving psoriatic plaques or promoting wound repair in psoriatic skin. Considering the biocompatibility, mechanical strength, flexibility, and adhesive properties of silk fibroin sheets/films, it is useful to combine them with anti-psoriatic agents and healing stimulants, notably silk sericin. Here, we evaluate the curative properties of sericin-coated thin polymeric films (ScF) fabricated from silk fibroin, using an imiquimod-induced psoriasis rat model. The film biocompatibility and psoriatic wound improvement capacity was assessed. A proteomics study was performed to understand the disease resolving mechanisms. Skin-implantation study exhibited the non-irritation property of ScF films, which alleviate eczema histopathology. Immunohistochemical and gene expression revealed the depletion of β-defensin, caspase-3 and -9, TNF-α, CCL-20, IL-1β, IL-17, TGF-β, and Wnt expressions and S100a14 mRNA level. The proteomics study suggested that ScF diminish keratinocyte proliferation via the mTOR pathway by downregulating mTOR protein, corresponding to the modulation of TNF-α, Wnt, and IL-1β levels, leading to the enhancement of anti-inflammatory environment by IL-17 downregulation. Hematology data demonstrated the safety of using these biomaterials, which provide a potential therapeutic-option for psoriasis treatment due to desirable effects, especially anti-proliferation and anti-inflammation, functioning via the mTOR pathway and control of IL-17 signaling. |
format | Online Article Text |
id | pubmed-10372088 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2023 |
publisher | Nature Publishing Group UK |
record_format | MEDLINE/PubMed |
spelling | pubmed-103720882023-07-28 Sericin coated thin polymeric films reduce keratinocyte proliferation via the mTOR pathway and epidermal inflammation through IL17 signaling in psoriasis rat model Aramwit, Pornanong Fongsodsri, Kamonpan Tuentam, Khwanchanok Reamtong, Onrapak Thiangtrongjit, Tipparat Kanjanapruthipong, Tapanee Yadavalli, Vamsi K. Ampawong, Sumate Sci Rep Article Therapeutic treatment forms can play significant roles in resolving psoriatic plaques or promoting wound repair in psoriatic skin. Considering the biocompatibility, mechanical strength, flexibility, and adhesive properties of silk fibroin sheets/films, it is useful to combine them with anti-psoriatic agents and healing stimulants, notably silk sericin. Here, we evaluate the curative properties of sericin-coated thin polymeric films (ScF) fabricated from silk fibroin, using an imiquimod-induced psoriasis rat model. The film biocompatibility and psoriatic wound improvement capacity was assessed. A proteomics study was performed to understand the disease resolving mechanisms. Skin-implantation study exhibited the non-irritation property of ScF films, which alleviate eczema histopathology. Immunohistochemical and gene expression revealed the depletion of β-defensin, caspase-3 and -9, TNF-α, CCL-20, IL-1β, IL-17, TGF-β, and Wnt expressions and S100a14 mRNA level. The proteomics study suggested that ScF diminish keratinocyte proliferation via the mTOR pathway by downregulating mTOR protein, corresponding to the modulation of TNF-α, Wnt, and IL-1β levels, leading to the enhancement of anti-inflammatory environment by IL-17 downregulation. Hematology data demonstrated the safety of using these biomaterials, which provide a potential therapeutic-option for psoriasis treatment due to desirable effects, especially anti-proliferation and anti-inflammation, functioning via the mTOR pathway and control of IL-17 signaling. Nature Publishing Group UK 2023-07-26 /pmc/articles/PMC10372088/ /pubmed/37495626 http://dx.doi.org/10.1038/s41598-023-39218-y Text en © The Author(s) 2023 https://creativecommons.org/licenses/by/4.0/Open Access This article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons licence, and indicate if changes were made. The images or other third party material in this article are included in the article's Creative Commons licence, unless indicated otherwise in a credit line to the material. If material is not included in the article's Creative Commons licence and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this licence, visit http://creativecommons.org/licenses/by/4.0/ (https://creativecommons.org/licenses/by/4.0/) . |
spellingShingle | Article Aramwit, Pornanong Fongsodsri, Kamonpan Tuentam, Khwanchanok Reamtong, Onrapak Thiangtrongjit, Tipparat Kanjanapruthipong, Tapanee Yadavalli, Vamsi K. Ampawong, Sumate Sericin coated thin polymeric films reduce keratinocyte proliferation via the mTOR pathway and epidermal inflammation through IL17 signaling in psoriasis rat model |
title | Sericin coated thin polymeric films reduce keratinocyte proliferation via the mTOR pathway and epidermal inflammation through IL17 signaling in psoriasis rat model |
title_full | Sericin coated thin polymeric films reduce keratinocyte proliferation via the mTOR pathway and epidermal inflammation through IL17 signaling in psoriasis rat model |
title_fullStr | Sericin coated thin polymeric films reduce keratinocyte proliferation via the mTOR pathway and epidermal inflammation through IL17 signaling in psoriasis rat model |
title_full_unstemmed | Sericin coated thin polymeric films reduce keratinocyte proliferation via the mTOR pathway and epidermal inflammation through IL17 signaling in psoriasis rat model |
title_short | Sericin coated thin polymeric films reduce keratinocyte proliferation via the mTOR pathway and epidermal inflammation through IL17 signaling in psoriasis rat model |
title_sort | sericin coated thin polymeric films reduce keratinocyte proliferation via the mtor pathway and epidermal inflammation through il17 signaling in psoriasis rat model |
topic | Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10372088/ https://www.ncbi.nlm.nih.gov/pubmed/37495626 http://dx.doi.org/10.1038/s41598-023-39218-y |
work_keys_str_mv | AT aramwitpornanong sericincoatedthinpolymericfilmsreducekeratinocyteproliferationviathemtorpathwayandepidermalinflammationthroughil17signalinginpsoriasisratmodel AT fongsodsrikamonpan sericincoatedthinpolymericfilmsreducekeratinocyteproliferationviathemtorpathwayandepidermalinflammationthroughil17signalinginpsoriasisratmodel AT tuentamkhwanchanok sericincoatedthinpolymericfilmsreducekeratinocyteproliferationviathemtorpathwayandepidermalinflammationthroughil17signalinginpsoriasisratmodel AT reamtongonrapak sericincoatedthinpolymericfilmsreducekeratinocyteproliferationviathemtorpathwayandepidermalinflammationthroughil17signalinginpsoriasisratmodel AT thiangtrongjittipparat sericincoatedthinpolymericfilmsreducekeratinocyteproliferationviathemtorpathwayandepidermalinflammationthroughil17signalinginpsoriasisratmodel AT kanjanapruthipongtapanee sericincoatedthinpolymericfilmsreducekeratinocyteproliferationviathemtorpathwayandepidermalinflammationthroughil17signalinginpsoriasisratmodel AT yadavallivamsik sericincoatedthinpolymericfilmsreducekeratinocyteproliferationviathemtorpathwayandepidermalinflammationthroughil17signalinginpsoriasisratmodel AT ampawongsumate sericincoatedthinpolymericfilmsreducekeratinocyteproliferationviathemtorpathwayandepidermalinflammationthroughil17signalinginpsoriasisratmodel |