Cargando…
Chemical inhibitors of cyclin-dependent kinase (CDKi) improve pancreatic endocrine differentiation of iPS cells
Islet transplantation, including pancreatic beta cells, has become an approved treatment for type I diabetes. To date, the number of donors limits the availability of treatment. Induction of pancreatic endocrine cells from pluripotent stem cells including iPSCs in vitro offers promise as a solution,...
Autores principales: | , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Springer US
2023
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10374832/ https://www.ncbi.nlm.nih.gov/pubmed/37405627 http://dx.doi.org/10.1007/s11626-023-00776-0 |
_version_ | 1785078862834565120 |
---|---|
author | Ning, Heming Horikawa, Ayumi Yamamoto, Takayoshi Michiue, Tatsuo |
author_facet | Ning, Heming Horikawa, Ayumi Yamamoto, Takayoshi Michiue, Tatsuo |
author_sort | Ning, Heming |
collection | PubMed |
description | Islet transplantation, including pancreatic beta cells, has become an approved treatment for type I diabetes. To date, the number of donors limits the availability of treatment. Induction of pancreatic endocrine cells from pluripotent stem cells including iPSCs in vitro offers promise as a solution, but continues to face problems including high reagent costs and cumbersome differentiation procedures. In a previous study, we developed a low-cost, simplified differentiation method, but its efficiency for inducing pancreatic endocrine cells was not sufficient: induction of endocrine cells is non-uniform, resulting in colonies containing relatively high ratio of non-pancreatic-related cells. Here, we applied cyclin-dependent kinase inhibitors (CDKi) within a specific time window, which improved the efficiency of pancreatic endocrine cell induction. CDKi treatment reduced the prevalence of multi-layered regions and enhanced expression of the endocrine progenitor–related marker genes PDX1 and NGN3 resulting in enhanced production of both INSULIN and GLUCAGON. These findings support a step forward in the field of regenerative medicine of pancreatic endocrine cells. SUPPLEMENTARY INFORMATION: The online version contains supplementary material available at 10.1007/s11626-023-00776-0. |
format | Online Article Text |
id | pubmed-10374832 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2023 |
publisher | Springer US |
record_format | MEDLINE/PubMed |
spelling | pubmed-103748322023-07-29 Chemical inhibitors of cyclin-dependent kinase (CDKi) improve pancreatic endocrine differentiation of iPS cells Ning, Heming Horikawa, Ayumi Yamamoto, Takayoshi Michiue, Tatsuo In Vitro Cell Dev Biol Anim Article Islet transplantation, including pancreatic beta cells, has become an approved treatment for type I diabetes. To date, the number of donors limits the availability of treatment. Induction of pancreatic endocrine cells from pluripotent stem cells including iPSCs in vitro offers promise as a solution, but continues to face problems including high reagent costs and cumbersome differentiation procedures. In a previous study, we developed a low-cost, simplified differentiation method, but its efficiency for inducing pancreatic endocrine cells was not sufficient: induction of endocrine cells is non-uniform, resulting in colonies containing relatively high ratio of non-pancreatic-related cells. Here, we applied cyclin-dependent kinase inhibitors (CDKi) within a specific time window, which improved the efficiency of pancreatic endocrine cell induction. CDKi treatment reduced the prevalence of multi-layered regions and enhanced expression of the endocrine progenitor–related marker genes PDX1 and NGN3 resulting in enhanced production of both INSULIN and GLUCAGON. These findings support a step forward in the field of regenerative medicine of pancreatic endocrine cells. SUPPLEMENTARY INFORMATION: The online version contains supplementary material available at 10.1007/s11626-023-00776-0. Springer US 2023-07-05 2023 /pmc/articles/PMC10374832/ /pubmed/37405627 http://dx.doi.org/10.1007/s11626-023-00776-0 Text en © The Author(s) 2023 https://creativecommons.org/licenses/by/4.0/Open Access This article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons licence, and indicate if changes were made. The images or other third party material in this article are included in the article's Creative Commons licence, unless indicated otherwise in a credit line to the material. If material is not included in the article's Creative Commons licence and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this licence, visit http://creativecommons.org/licenses/by/4.0/ (https://creativecommons.org/licenses/by/4.0/) . |
spellingShingle | Article Ning, Heming Horikawa, Ayumi Yamamoto, Takayoshi Michiue, Tatsuo Chemical inhibitors of cyclin-dependent kinase (CDKi) improve pancreatic endocrine differentiation of iPS cells |
title | Chemical inhibitors of cyclin-dependent kinase (CDKi) improve pancreatic endocrine differentiation of iPS cells |
title_full | Chemical inhibitors of cyclin-dependent kinase (CDKi) improve pancreatic endocrine differentiation of iPS cells |
title_fullStr | Chemical inhibitors of cyclin-dependent kinase (CDKi) improve pancreatic endocrine differentiation of iPS cells |
title_full_unstemmed | Chemical inhibitors of cyclin-dependent kinase (CDKi) improve pancreatic endocrine differentiation of iPS cells |
title_short | Chemical inhibitors of cyclin-dependent kinase (CDKi) improve pancreatic endocrine differentiation of iPS cells |
title_sort | chemical inhibitors of cyclin-dependent kinase (cdki) improve pancreatic endocrine differentiation of ips cells |
topic | Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10374832/ https://www.ncbi.nlm.nih.gov/pubmed/37405627 http://dx.doi.org/10.1007/s11626-023-00776-0 |
work_keys_str_mv | AT ningheming chemicalinhibitorsofcyclindependentkinasecdkiimprovepancreaticendocrinedifferentiationofipscells AT horikawaayumi chemicalinhibitorsofcyclindependentkinasecdkiimprovepancreaticendocrinedifferentiationofipscells AT yamamototakayoshi chemicalinhibitorsofcyclindependentkinasecdkiimprovepancreaticendocrinedifferentiationofipscells AT michiuetatsuo chemicalinhibitorsofcyclindependentkinasecdkiimprovepancreaticendocrinedifferentiationofipscells |