Cargando…

Appraising the causal relationship between plasma caffeine levels and neuropsychiatric disorders through Mendelian randomization

BACKGROUND: Caffeine exposure modifies the turnover of monoamine neurotransmitters, which play a role in several neuropsychiatric disorders. We conducted a Mendelian randomization study to investigate whether higher plasma caffeine levels are causally associated with the risk of anorexia nervosa, bi...

Descripción completa

Detalles Bibliográficos
Autores principales: Woolf, Benjamin, Cronjé, Héléne T., Zagkos, Loukas, Burgess, Stephen, Gill, Dipender, Larsson, Susanna C.
Formato: Online Artículo Texto
Lenguaje:English
Publicado: BioMed Central 2023
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10408049/
https://www.ncbi.nlm.nih.gov/pubmed/37553644
http://dx.doi.org/10.1186/s12916-023-03008-0
_version_ 1785086098600361984
author Woolf, Benjamin
Cronjé, Héléne T.
Zagkos, Loukas
Burgess, Stephen
Gill, Dipender
Larsson, Susanna C.
author_facet Woolf, Benjamin
Cronjé, Héléne T.
Zagkos, Loukas
Burgess, Stephen
Gill, Dipender
Larsson, Susanna C.
author_sort Woolf, Benjamin
collection PubMed
description BACKGROUND: Caffeine exposure modifies the turnover of monoamine neurotransmitters, which play a role in several neuropsychiatric disorders. We conducted a Mendelian randomization study to investigate whether higher plasma caffeine levels are causally associated with the risk of anorexia nervosa, bipolar disorder, major depressive disorder (MDD), and schizophrenia. METHODS: Summary-level data on the neuropsychiatric disorders were obtained from large-scale genome-wide association studies (GWASs) of European ancestry participants (n = 72,517 to 807,553) and meta-analyzed with the corresponding data from the FinnGen study (n = 356,077). Summary-level data on plasma caffeine were extracted from a GWAS meta-analysis of 9876 European ancestry individuals. The Mendelian randomization analyses estimated the Wald ratio for each genetic variant and meta-analyzed the variant-specific estimates using multiplicative random effects meta-analysis. RESULTS: After correcting for multiple testing, genetically predicted higher plasma caffeine levels were associated with higher odds of anorexia nervosa (odds ratio [OR] = 1.124; 95% confidence interval [CI] = 1.024–1.238, p(FDR) = 0.039) and a lower odds of bipolar disorder (OR = 0.905, 95% CI = 0.827–0.929, p(FDR) = 0.041) and MDD (OR = 0.965, 95% CI = 0.937–0.995, p(FDR) = 0.039). Instrumented plasma caffeine levels were not associated with schizophrenia (OR = 0.986, 95% CI = 0.929–1.047, p(FDR) = 0.646). CONCLUSIONS: These Mendelian randomization findings indicate that long-term higher plasma caffeine levels may lower the risk of bipolar disorder and MDD but increase the risk of anorexia nervosa. These results warrant further research to explore whether caffeine consumption, supplementation, or abstinence could render clinically relevant therapeutic or preventative psychiatric effects. SUPPLEMENTARY INFORMATION: The online version contains supplementary material available at 10.1186/s12916-023-03008-0.
format Online
Article
Text
id pubmed-10408049
institution National Center for Biotechnology Information
language English
publishDate 2023
publisher BioMed Central
record_format MEDLINE/PubMed
spelling pubmed-104080492023-08-09 Appraising the causal relationship between plasma caffeine levels and neuropsychiatric disorders through Mendelian randomization Woolf, Benjamin Cronjé, Héléne T. Zagkos, Loukas Burgess, Stephen Gill, Dipender Larsson, Susanna C. BMC Med Research Article BACKGROUND: Caffeine exposure modifies the turnover of monoamine neurotransmitters, which play a role in several neuropsychiatric disorders. We conducted a Mendelian randomization study to investigate whether higher plasma caffeine levels are causally associated with the risk of anorexia nervosa, bipolar disorder, major depressive disorder (MDD), and schizophrenia. METHODS: Summary-level data on the neuropsychiatric disorders were obtained from large-scale genome-wide association studies (GWASs) of European ancestry participants (n = 72,517 to 807,553) and meta-analyzed with the corresponding data from the FinnGen study (n = 356,077). Summary-level data on plasma caffeine were extracted from a GWAS meta-analysis of 9876 European ancestry individuals. The Mendelian randomization analyses estimated the Wald ratio for each genetic variant and meta-analyzed the variant-specific estimates using multiplicative random effects meta-analysis. RESULTS: After correcting for multiple testing, genetically predicted higher plasma caffeine levels were associated with higher odds of anorexia nervosa (odds ratio [OR] = 1.124; 95% confidence interval [CI] = 1.024–1.238, p(FDR) = 0.039) and a lower odds of bipolar disorder (OR = 0.905, 95% CI = 0.827–0.929, p(FDR) = 0.041) and MDD (OR = 0.965, 95% CI = 0.937–0.995, p(FDR) = 0.039). Instrumented plasma caffeine levels were not associated with schizophrenia (OR = 0.986, 95% CI = 0.929–1.047, p(FDR) = 0.646). CONCLUSIONS: These Mendelian randomization findings indicate that long-term higher plasma caffeine levels may lower the risk of bipolar disorder and MDD but increase the risk of anorexia nervosa. These results warrant further research to explore whether caffeine consumption, supplementation, or abstinence could render clinically relevant therapeutic or preventative psychiatric effects. SUPPLEMENTARY INFORMATION: The online version contains supplementary material available at 10.1186/s12916-023-03008-0. BioMed Central 2023-08-08 /pmc/articles/PMC10408049/ /pubmed/37553644 http://dx.doi.org/10.1186/s12916-023-03008-0 Text en © The Author(s) 2023 https://creativecommons.org/licenses/by/4.0/Open Access This article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons licence, and indicate if changes were made. The images or other third party material in this article are included in the article's Creative Commons licence, unless indicated otherwise in a credit line to the material. If material is not included in the article's Creative Commons licence and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this licence, visit http://creativecommons.org/licenses/by/4.0/ (https://creativecommons.org/licenses/by/4.0/) . The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/ (https://creativecommons.org/publicdomain/zero/1.0/) ) applies to the data made available in this article, unless otherwise stated in a credit line to the data.
spellingShingle Research Article
Woolf, Benjamin
Cronjé, Héléne T.
Zagkos, Loukas
Burgess, Stephen
Gill, Dipender
Larsson, Susanna C.
Appraising the causal relationship between plasma caffeine levels and neuropsychiatric disorders through Mendelian randomization
title Appraising the causal relationship between plasma caffeine levels and neuropsychiatric disorders through Mendelian randomization
title_full Appraising the causal relationship between plasma caffeine levels and neuropsychiatric disorders through Mendelian randomization
title_fullStr Appraising the causal relationship between plasma caffeine levels and neuropsychiatric disorders through Mendelian randomization
title_full_unstemmed Appraising the causal relationship between plasma caffeine levels and neuropsychiatric disorders through Mendelian randomization
title_short Appraising the causal relationship between plasma caffeine levels and neuropsychiatric disorders through Mendelian randomization
title_sort appraising the causal relationship between plasma caffeine levels and neuropsychiatric disorders through mendelian randomization
topic Research Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10408049/
https://www.ncbi.nlm.nih.gov/pubmed/37553644
http://dx.doi.org/10.1186/s12916-023-03008-0
work_keys_str_mv AT woolfbenjamin appraisingthecausalrelationshipbetweenplasmacaffeinelevelsandneuropsychiatricdisordersthroughmendelianrandomization
AT cronjehelenet appraisingthecausalrelationshipbetweenplasmacaffeinelevelsandneuropsychiatricdisordersthroughmendelianrandomization
AT zagkosloukas appraisingthecausalrelationshipbetweenplasmacaffeinelevelsandneuropsychiatricdisordersthroughmendelianrandomization
AT burgessstephen appraisingthecausalrelationshipbetweenplasmacaffeinelevelsandneuropsychiatricdisordersthroughmendelianrandomization
AT gilldipender appraisingthecausalrelationshipbetweenplasmacaffeinelevelsandneuropsychiatricdisordersthroughmendelianrandomization
AT larssonsusannac appraisingthecausalrelationshipbetweenplasmacaffeinelevelsandneuropsychiatricdisordersthroughmendelianrandomization