Cargando…
Prevalence and factors associated with suicidal ideation, cannabis, and alcohol use during the COVID-19 pandemic in Saskatchewan: findings from a joint-effect modeling
BACKGROUND: Generally, pandemics such as COVID-19 take an enormous toll on people’s lives. As the pandemic now turns to an endemic state, growing attention has been paid to the multiple adverse mental health and behavioral issues, such as suicidal ideation and substance use. However, the interplay o...
Autores principales: | , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
BioMed Central
2023
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10408153/ https://www.ncbi.nlm.nih.gov/pubmed/37553652 http://dx.doi.org/10.1186/s12888-023-05051-w |
_version_ | 1785086124620775424 |
---|---|
author | Adeyinka, Daniel A. Novik, Nuelle Novotna, Gabriela Bartram, Mary Gabrys, Robert Muhajarine, Nazeem |
author_facet | Adeyinka, Daniel A. Novik, Nuelle Novotna, Gabriela Bartram, Mary Gabrys, Robert Muhajarine, Nazeem |
author_sort | Adeyinka, Daniel A. |
collection | PubMed |
description | BACKGROUND: Generally, pandemics such as COVID-19 take an enormous toll on people’s lives. As the pandemic now turns to an endemic state, growing attention has been paid to the multiple adverse mental health and behavioral issues, such as suicidal ideation and substance use. However, the interplay of suicidality and substance misuse during the pandemic has been limited. We aimed to investigate the prevalence of co-occurrence of suicide ideation, alcohol and cannabis misuse, and the factors that are associated with these co-occurrences in the province of Saskatchewan during the COVID-19 pandemic. METHODS: We performed a multivariable trivariate probit regression on a sample of 666 Saskatchewan adolescents and adults (16 years or older), drawn from the cycle 10 data collection (March 2022) of the Mental Health Commission of Canada, and Canadian Centre on Substance Use and Addiction (MHCC-CCSA) dataset. RESULTS: The prevalence of suicidal ideation was higher among respondents who reported both problematic cannabis and alcohol use (25.8%) than single users of alcohol (23.2%) and cannabis (18.7%). Younger respondents (16–34 years) and those who reported recent changes in other substance use were independent factors that were associated with the common experience of suicide ideation, problematic cannabis, and alcohol use. Having a diagnosis of mental health disorders either before or during the pandemic, and the perceived inability to bounce back after the pandemic (low resilience) are strong correlates of suicidal ideation. Those who lived alone, between 35 and 55 years of age were more likely to report problematic alcohol use. Those who reported changes in alternative activities, who reported pandemic stress, and declared a LGBTQIA2S + identity had higher probability of problematic cannabis use. CONCLUSIONS: As the pandemic persists, improving access to suicide and substance use interventions for the vulnerable groups identified in this study may be impactful. SUPPLEMENTARY INFORMATION: The online version contains supplementary material available at 10.1186/s12888-023-05051-w. |
format | Online Article Text |
id | pubmed-10408153 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2023 |
publisher | BioMed Central |
record_format | MEDLINE/PubMed |
spelling | pubmed-104081532023-08-09 Prevalence and factors associated with suicidal ideation, cannabis, and alcohol use during the COVID-19 pandemic in Saskatchewan: findings from a joint-effect modeling Adeyinka, Daniel A. Novik, Nuelle Novotna, Gabriela Bartram, Mary Gabrys, Robert Muhajarine, Nazeem BMC Psychiatry Research BACKGROUND: Generally, pandemics such as COVID-19 take an enormous toll on people’s lives. As the pandemic now turns to an endemic state, growing attention has been paid to the multiple adverse mental health and behavioral issues, such as suicidal ideation and substance use. However, the interplay of suicidality and substance misuse during the pandemic has been limited. We aimed to investigate the prevalence of co-occurrence of suicide ideation, alcohol and cannabis misuse, and the factors that are associated with these co-occurrences in the province of Saskatchewan during the COVID-19 pandemic. METHODS: We performed a multivariable trivariate probit regression on a sample of 666 Saskatchewan adolescents and adults (16 years or older), drawn from the cycle 10 data collection (March 2022) of the Mental Health Commission of Canada, and Canadian Centre on Substance Use and Addiction (MHCC-CCSA) dataset. RESULTS: The prevalence of suicidal ideation was higher among respondents who reported both problematic cannabis and alcohol use (25.8%) than single users of alcohol (23.2%) and cannabis (18.7%). Younger respondents (16–34 years) and those who reported recent changes in other substance use were independent factors that were associated with the common experience of suicide ideation, problematic cannabis, and alcohol use. Having a diagnosis of mental health disorders either before or during the pandemic, and the perceived inability to bounce back after the pandemic (low resilience) are strong correlates of suicidal ideation. Those who lived alone, between 35 and 55 years of age were more likely to report problematic alcohol use. Those who reported changes in alternative activities, who reported pandemic stress, and declared a LGBTQIA2S + identity had higher probability of problematic cannabis use. CONCLUSIONS: As the pandemic persists, improving access to suicide and substance use interventions for the vulnerable groups identified in this study may be impactful. SUPPLEMENTARY INFORMATION: The online version contains supplementary material available at 10.1186/s12888-023-05051-w. BioMed Central 2023-08-08 /pmc/articles/PMC10408153/ /pubmed/37553652 http://dx.doi.org/10.1186/s12888-023-05051-w Text en © The Author(s) 2023 https://creativecommons.org/licenses/by/4.0/Open Access This article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons licence, and indicate if changes were made. The images or other third party material in this article are included in the article's Creative Commons licence, unless indicated otherwise in a credit line to the material. If material is not included in the article's Creative Commons licence and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this licence, visit http://creativecommons.org/licenses/by/4.0/ (https://creativecommons.org/licenses/by/4.0/) . The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/ (https://creativecommons.org/publicdomain/zero/1.0/) ) applies to the data made available in this article, unless otherwise stated in a credit line to the data. |
spellingShingle | Research Adeyinka, Daniel A. Novik, Nuelle Novotna, Gabriela Bartram, Mary Gabrys, Robert Muhajarine, Nazeem Prevalence and factors associated with suicidal ideation, cannabis, and alcohol use during the COVID-19 pandemic in Saskatchewan: findings from a joint-effect modeling |
title | Prevalence and factors associated with suicidal ideation, cannabis, and alcohol use during the COVID-19 pandemic in Saskatchewan: findings from a joint-effect modeling |
title_full | Prevalence and factors associated with suicidal ideation, cannabis, and alcohol use during the COVID-19 pandemic in Saskatchewan: findings from a joint-effect modeling |
title_fullStr | Prevalence and factors associated with suicidal ideation, cannabis, and alcohol use during the COVID-19 pandemic in Saskatchewan: findings from a joint-effect modeling |
title_full_unstemmed | Prevalence and factors associated with suicidal ideation, cannabis, and alcohol use during the COVID-19 pandemic in Saskatchewan: findings from a joint-effect modeling |
title_short | Prevalence and factors associated with suicidal ideation, cannabis, and alcohol use during the COVID-19 pandemic in Saskatchewan: findings from a joint-effect modeling |
title_sort | prevalence and factors associated with suicidal ideation, cannabis, and alcohol use during the covid-19 pandemic in saskatchewan: findings from a joint-effect modeling |
topic | Research |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC10408153/ https://www.ncbi.nlm.nih.gov/pubmed/37553652 http://dx.doi.org/10.1186/s12888-023-05051-w |
work_keys_str_mv | AT adeyinkadaniela prevalenceandfactorsassociatedwithsuicidalideationcannabisandalcoholuseduringthecovid19pandemicinsaskatchewanfindingsfromajointeffectmodeling AT noviknuelle prevalenceandfactorsassociatedwithsuicidalideationcannabisandalcoholuseduringthecovid19pandemicinsaskatchewanfindingsfromajointeffectmodeling AT novotnagabriela prevalenceandfactorsassociatedwithsuicidalideationcannabisandalcoholuseduringthecovid19pandemicinsaskatchewanfindingsfromajointeffectmodeling AT bartrammary prevalenceandfactorsassociatedwithsuicidalideationcannabisandalcoholuseduringthecovid19pandemicinsaskatchewanfindingsfromajointeffectmodeling AT gabrysrobert prevalenceandfactorsassociatedwithsuicidalideationcannabisandalcoholuseduringthecovid19pandemicinsaskatchewanfindingsfromajointeffectmodeling AT muhajarinenazeem prevalenceandfactorsassociatedwithsuicidalideationcannabisandalcoholuseduringthecovid19pandemicinsaskatchewanfindingsfromajointeffectmodeling |